Index of /ca.cdn.preterhuman.net/texts/unsorted

[ICO]NameLast modifiedSizeDescription

[PARENTDIR]Parent Directory  -  
[TXT]‘Patriotism’ is the Last Refuge of the Scoundrel.htm2012-10-01 17:32 4.9K 
[DIR]‘Patriotism’ is the Last Refuge of the Scoundrel_files/2015-10-04 18:43 -  
[TXT]'Affirmative Action' Chief Latest 'Victim' of Katrina.htm2012-10-01 17:31 3.0K 
[DIR]'Affirmative Action' Chief Latest 'Victim' of Katrina_files/2015-10-04 18:43 -  
[TXT]'Anti-Semitism' Center Set Up at Yale.htm2012-10-01 17:30 4.5K 
[DIR]'Anti-Semitism' Center Set Up at Yale_files/2015-10-04 18:43 -  
[TXT]'Border Baby' Boom Strains South Texas.htm2012-10-01 17:28 4.6K 
[DIR]'Border Baby' Boom Strains South Texas_files/2015-10-04 18:43 -  
[TXT]'Down Low' Lifestyle Causing AIDS Epidemic Among Blacks.htm2012-10-01 17:33 6.6K 
[DIR]'Down Low' Lifestyle Causing AIDS Epidemic Among Blacks_files/2015-10-04 18:43 -  
[TXT]'Down Low' Lifestyle Suspected in Porn Industry HIV Scare.htm2012-10-01 17:33 3.5K 
[DIR]'Down Low' Lifestyle Suspected in Porn Industry HIV Scare_files/2015-10-04 18:43 -  
[TXT]'Feldman' Attack on 'Passion' is a Hoax.htm2012-10-01 17:27 5.1K 
[TXT]'Gay' Groups Fight Parents Over School's Mandatory Homosexual Indoctrination.htm2012-10-01 17:29 4.5K 
[DIR]'Gay' Groups Fight Parents Over School's Mandatory Homosexual Indoctrination_files/2015-10-04 18:43 -  
[TXT]'Governator' Refuses Tookie Clemency.htm2012-10-01 17:32 24K 
[DIR]'Governator' Refuses Tookie Clemency_files/2015-10-04 18:43 -  
[TXT]'Hate crime' victims - Young, poor, white - 2006-02-22.txt2012-10-01 17:28 4.3K 
[TXT]'IQ' vs. Standardized Tests.htm2012-10-01 17:27 149K 
[DIR]'IQ' vs. Standardized Tests_files/2015-10-04 18:43 -  
[TXT]'I Was a Victim of Racial Violence in Junior High'.htm2012-10-01 17:30 7.0K 
[DIR]'I Was a Victim of Racial Violence in Junior High'_files/2015-10-04 18:43 -  
[TXT]'Madonna' - Diva of Degeneracy to Perform in Israel.htm2012-10-01 17:31 2.6K 
[DIR]'Madonna' - Diva of Degeneracy to Perform in Israel_files/2015-10-04 18:43 -  
[TXT]'Mighty Whitey' Defends Algiers Point.htm2012-10-01 17:30 4.0K 
[DIR]'Mighty Whitey' Defends Algiers Point_files/2015-10-04 18:43 -  
[TXT]'Mud Duck' - Vang Trial Hits Emotional Peak.htm2012-10-01 17:30 4.5K 
[DIR]'Mud Duck' - Vang Trial Hits Emotional Peak_files/2015-10-04 18:43 -  
[TXT]'Neutral' Official to KLA - 'Careful With Those Grenades'.htm2012-10-01 17:34 2.8K 
[DIR]'Neutral' Official to KLA - 'Careful With Those Grenades'_files/2015-10-04 18:43 -  
[TXT]'Sugar daddies' fuelling HIV spread.htm2012-10-01 17:32 4.3K 
[DIR]'Sugar daddies' fuelling HIV spread_files/2015-10-04 18:43 -  
[TXT]'The Jews are being pulled from their palaces, decapitated, and fed to the dogs'.htm2012-10-01 17:33 6.8K 
[TXT]'Tolerance' Runs Out for Firm.htm2012-10-01 17:31 3.9K 
[DIR]'Tolerance' Runs Out for Firm_files/2015-10-04 18:43 -  
[TXT]'Voices of Heaven' Ordered Not to Sing Sacred Music.htm2012-10-01 17:33 2.6K 
[DIR]'Voices of Heaven' Ordered Not to Sing Sacred Music_files/2015-10-04 18:43 -  
[TXT]0,,31580,00.html2012-10-01 17:28 1.2K 
[TXT]0208issue.html2012-10-01 17:28 159K 
[TXT]0209issue.html2012-10-01 17:28 126K 
[TXT]0210issue.html2012-10-01 17:32 145K 
[TXT]0211issue.html2012-10-01 17:28 135K 
[TXT]0212issue.html2012-10-01 17:29 137K 
[TXT]0301issue.html2012-10-01 17:31 148K 
[TXT]0302issue.html2012-10-01 17:34 136K 
[TXT]0303issue.html2012-10-01 17:31 143K 
[TXT]0304issue.html2012-10-01 17:32 139K 
[TXT]0305issue.html2012-10-01 17:33 143K 
[TXT]0306issue.html2012-10-01 17:30 155K 
[TXT]0307issue.html2012-10-01 17:30 155K 
[TXT]0308issue.html2012-10-01 17:33 156K 
[TXT]0309issue.html2012-10-01 17:33 147K 
[TXT]0310issue.html2012-10-01 17:32 113K 
[TXT]0311issue.html2012-10-01 17:33 151K 
[TXT]0312issue.htm2012-10-01 17:31 137K 
[TXT]0401issue.html2012-10-01 17:31 150K 
[TXT]0402issue.html2012-10-01 17:30 147K 
[TXT]0403issue.html2012-10-01 17:30 144K 
[TXT]0404issue.html2012-10-01 17:31 154K 
[TXT]0405issue.html2012-10-01 17:30 144K 
[TXT]0406issue.html2012-10-01 17:29 151K 
[TXT]0407issue.html2012-10-01 17:27 144K 
[TXT]0408issue.html2012-10-01 17:30 148K 
[TXT]0409issue.html2012-10-01 17:28 153K 
[TXT]0410issue.html2012-10-01 17:28 153K 
[TXT]0411issue.htm2012-10-01 17:33 148K 
[TXT]0412issue.html2012-10-01 17:32 143K 
[   ]0506wiesendemo.pdf2012-10-01 17:29 226K 
[   ]2_On_Being_White.PDF2012-10-01 17:31 276K 
[TXT]2 standards for diversity in the legal fraternity.htm2012-10-01 17:28 5.0K 
[DIR]2 standards for diversity in the legal fraternity_files/2015-10-04 18:43 -  
[   ]6millionmyth.pdf2012-10-01 17:28 182K 
[   ]6millionmyth.rtf2012-10-01 17:28 215K 
[TXT]9-11 Families Demand Action on Immigration.htm2012-10-01 17:30 3.0K 
[DIR]9-11 Families Demand Action on Immigration_files/2015-10-04 18:43 -  
[   ]13tribe.pdf2012-10-01 17:32 446K 
[   ]13tribe.rtf2012-10-01 17:28 1.8M 
[TXT]15,000 Hmong Head for Minnesota.htm2012-10-01 17:31 2.8K 
[DIR]15,000 Hmong Head for Minnesota_files/2015-10-04 18:43 -  
[TXT]16.3allen.pdf.htm2012-10-01 17:28 8.2K 
[   ]16CrucifiedSaviors.pdf2012-10-01 17:31 1.5M 
[   ]36-ferrocement-water-tanks.pdf2012-10-01 17:34 203K 
[TXT]50 Cent Gives New Meaning to 'Da Bomb'.htm2012-10-01 17:32 2.9K 
[DIR]50 Cent Gives New Meaning to 'Da Bomb'_files/2015-10-04 18:43 -  
[   ]53-francis.pdf2012-10-01 17:34 177K 
[   ]53-km-slezkine.pdf2012-10-01 17:34 273K 
[   ]53-wch-script.pdf2012-10-01 17:32 265K 
[   ]66QnA.pdf2012-10-01 17:32 48K 
[TXT]72.3bentley.pdf.htm2012-10-01 17:28 7.1K 
[TXT]80 BC - The White World’s Oldest Computer.htm2012-10-01 17:33 4.5K 
[   ]88Precepts.pdf2012-10-01 17:31 21K 
[   ]88Precepts.rtf2012-10-01 17:31 37K 
[   ]90December.pdf2012-10-01 17:30 421K 
[   ]90November.pdf2012-10-01 17:30 306K 
[   ]91April.pdf2012-10-01 17:30 485K 
[   ]91February.pdf2012-10-01 17:31 334K 
[   ]91January.pdf2012-10-01 17:27 346K 
[   ]91July.pdf2012-10-01 17:29 417K 
[   ]91March.pdf2012-10-01 17:30 359K 
[   ]94June.pdf2012-10-01 17:28 588K 
[   ]95February.pdf2012-10-01 17:30 450K 
[   ]95March.pdf2012-10-01 17:30 515K 
[   ]96August.pdf2012-10-01 17:31 633K 
[   ]96December.pdf2012-10-01 17:31 514K 
[   ]96January.pdf2012-10-01 17:31 442K 
[   ]96July.pdf2012-10-01 17:30 630K 
[   ]96June.pdf2012-10-01 17:30 554K 
[   ]96November.pdf2012-10-01 17:33 487K 
[   ]96October.pdf2012-10-01 17:33 746K 
[   ]96September.pdf2012-10-01 17:31 494K 
[   ]97April.pdf2012-10-01 17:31 455K 
[   ]97December.pdf2012-10-01 17:33 495K 
[   ]97February.pdf2012-10-01 17:33 441K 
[   ]97January.pdf2012-10-01 17:28 462K 
[   ]97Jul-Aug.pdf2012-10-01 17:33 1.0M 
[   ]97June.pdf2012-10-01 17:31 458K 
[   ]97March.pdf2012-10-01 17:28 478K 
[   ]97May.pdf2012-10-01 17:32 585K 
[   ]97November.pdf2012-10-01 17:31 558K 
[   ]97October.pdf2012-10-01 17:32 494K 
[   ]97September(1).pdf2012-10-01 17:32 502K 
[   ]97September.pdf2012-10-01 17:28 502K 
[   ]98April.pdf2012-10-01 17:28 558K 
[   ]98August.pdf2012-10-01 17:32 542K 
[   ]98December.pdf2012-10-01 17:34 845K 
[   ]98February.pdf2012-10-01 17:27 641K 
[   ]98January.pdf2012-10-01 17:29 489K 
[   ]98July.pdf2012-10-01 17:27 548K 
[   ]98June.pdf2012-10-01 17:31 338K 
[   ]98March(1).pdf2012-10-01 17:32 514K 
[   ]98March.pdf2012-10-01 17:29 514K 
[   ]98May.pdf2012-10-01 17:32 426K 
[   ]98November.pdf2012-10-01 17:31 1.2M 
[   ]98October.pdf2012-10-01 17:28 687K 
[   ]98September.pdf2012-10-01 17:31 620K 
[   ]99April.pdf2012-10-01 17:32 316K 
[   ]99August.pdf2012-10-01 17:27 262K 
[   ]99December.pdf2012-10-01 17:28 415K 
[   ]99February.pdf2012-10-01 17:33 296K 
[   ]99January.pdf2012-10-01 17:31 361K 
[   ]99July.pdf2012-10-01 17:29 321K 
[   ]99June.pdf2012-10-01 17:31 285K 
[   ]99March.pdf2012-10-01 17:33 283K 
[   ]99May.pdf2012-10-01 17:32 270K 
[   ]99November.pdf2012-10-01 17:34 330K 
[   ]99October.pdf2012-10-01 17:31 270K 
[   ]99September.pdf2012-10-01 17:30 271K 
[TXT]100 Million Dead - JEWS AND COMMUNISM Part 1.htm2012-10-01 17:28 42K 
[DIR]100 Million Dead - JEWS AND COMMUNISM Part 1_files/2015-10-04 18:43 -  
[TXT]100 Million Dead - JEWS AND COMMUNISM Part 2.htm2012-10-01 17:33 41K 
[DIR]100 Million Dead - JEWS AND COMMUNISM Part 2_files/2015-10-04 18:43 -  
[TXT]100 Million Dead - JEWS AND COMMUNISM Part 3.htm2012-10-01 17:28 39K 
[DIR]100 Million Dead - JEWS AND COMMUNISM Part 3_files/2015-10-04 18:43 -  
[   ]100ReasonsWereGladToBeMen.pdf2012-10-01 17:32 6.5K 
[   ]100waystolivefree.pdf2012-10-01 17:31 40K 
[   ]105HolocaustQuestions.pdf2012-10-01 17:30 94K 
[   ]110.Eine_niedere_Form.pdf2012-10-01 17:33 101K 
[   ]110.Geistige_Behinderung.pdf2012-10-01 17:32 160K 
[   ]131Sample.pdf2012-10-01 17:30 294K 
[TXT]260 million CHRISTIAN Lives Lost.htm2012-10-01 17:31 53K 
[DIR]260 million CHRISTIAN Lives Lost_files/2015-10-04 18:43 -  
[   ]365days.pdf2012-10-01 17:30 14M 
[TXT]911issue.html2012-10-01 17:32 61K 
[   ]911report.pdf2012-10-01 17:28 7.2M 
[   ]911report.rtf2012-10-01 17:34 15M 
[TXT]912issue.html2012-10-01 17:30 59K 
[TXT]913issue.html2012-10-01 17:32 60K 
[TXT]914issue.html2012-10-01 17:28 57K 
[TXT]915issue.html2012-10-01 17:34 61K 
[TXT]916issue.html2012-10-01 17:28 66K 
[TXT]921issue.html2012-10-01 17:28 76K 
[TXT]922issue.html2012-10-01 17:34 64K 
[TXT]923issue.html2012-10-01 17:29 65K 
[TXT]924issue.html2012-10-01 17:33 61K 
[TXT]925issue.html2012-10-01 17:28 64K 
[TXT]926issue.html2012-10-01 17:34 74K 
[TXT]927issue.html2012-10-01 17:29 61K 
[TXT]928issue.html2012-10-01 17:31 63K 
[TXT]931issue.html2012-10-01 17:31 64K 
[TXT]932issue.html2012-10-01 17:33 59K 
[TXT]933issue.html2012-10-01 17:28 61K 
[TXT]934issue.html2012-10-01 17:31 62K 
[TXT]935issue.html2012-10-01 17:31 62K 
[TXT]936issue.html2012-10-01 17:28 61K 
[TXT]937issue.html2012-10-01 17:31 61K 
[TXT]938issue.html2012-10-01 17:28 61K 
[TXT]939issue.html2012-10-01 17:34 120K 
[TXT]941issue.html2012-10-01 17:30 64K 
[TXT]942issue.html2012-10-01 17:32 57K 
[TXT]943issue.html2012-10-01 17:33 59K 
[TXT]944issue.html2012-10-01 17:34 57K 
[TXT]945issue.html2012-10-01 17:30 59K 
[TXT]946issue.html2012-10-01 17:33 57K 
[TXT]947issue.html2012-10-01 17:34 64K 
[TXT]948issue.html2012-10-01 17:34 70K 
[TXT]949issue.html2012-10-01 17:31 72K 
[TXT]951issue.html2012-10-01 17:28 78K 
[TXT]952issue.html2012-10-01 17:28 83K 
[TXT]953issue.html2012-10-01 17:34 80K 
[TXT]954issue.html2012-10-01 17:31 76K 
[TXT]955issue.html2012-10-01 17:32 78K 
[TXT]956issue.html2012-10-01 17:31 76K 
[TXT]957issue.html2012-10-01 17:27 80K 
[TXT]958issue.html2012-10-01 17:30 79K 
[TXT]959issue.html2012-10-01 17:30 81K 
[TXT]961issue.html2012-10-01 17:33 81K 
[TXT]962issue.html2012-10-01 17:28 82K 
[TXT]963issue.html2012-10-01 17:28 78K 
[TXT]964issue.html2012-10-01 17:28 78K 
[TXT]965issue.html2012-10-01 17:32 76K 
[TXT]966issue.html2012-10-01 17:33 70K 
[TXT]967issue.html2012-10-01 17:31 79K 
[TXT]968issue.html2012-10-01 17:28 74K 
[TXT]969issue.html2012-10-01 17:33 77K 
[TXT]971issue.html2012-10-01 17:29 83K 
[TXT]972issue.html2012-10-01 17:30 81K 
[TXT]973issue.html2012-10-01 17:32 92K 
[TXT]974issue.html2012-10-01 17:34 80K 
[TXT]975issue.html2012-10-01 17:34 77K 
[TXT]976issue.html2012-10-01 17:31 88K 
[TXT]979issue.html2012-10-01 17:33 85K 
[TXT]981issue.html2012-10-01 17:33 89K 
[TXT]982issue.html2012-10-01 17:27 94K 
[TXT]983issue.html2012-10-01 17:28 85K 
[TXT]984issue.html2012-10-01 17:31 82K 
[TXT]985issue.html2012-10-01 17:33 78K 
[TXT]986issue.html2012-10-01 17:33 77K 
[TXT]987issue.html2012-10-01 17:30 82K 
[TXT]988issue.html2012-10-01 17:34 76K 
[TXT]989issue.html2012-10-01 17:31 78K 
[TXT]991issue.html2012-10-01 17:31 119K 
[TXT]992issue.html2012-10-01 17:33 111K 
[TXT]993issue.html2012-10-01 17:28 118K 
[TXT]994issue.html2012-10-01 17:30 111K 
[TXT]995issue.html2012-10-01 17:33 77K 
[TXT]996issue.html2012-10-01 17:31 85K 
[TXT]997issue.html2012-10-01 17:28 103K 
[TXT]998issue.html2012-10-01 17:31 85K 
[TXT]999issue.html2012-10-01 17:28 111K 
[   ]1984.pdf2012-10-01 17:28 564K 
[   ]1984.rtf2012-10-01 17:33 712K 
[   ]1984.zip2012-10-01 17:33 367K 
[TXT]2005-12-07 - Wanted - More Race Realism, Less Moralistic.htm2012-10-01 17:28 45K 
[DIR]2005-12-07 - Wanted - More Race Realism, Less Moralistic_files/2015-10-04 18:43 -  
[TXT]2005-12-07 - wanted_more_race_realism_less.php.htm2012-10-01 17:28 363K 
[DIR]2005-12-07 - wanted_more_race_realism_less.php_files/2015-10-04 18:43 -  
[   ]5700IsraelAid.pdf2012-10-01 17:33 139K 
[TXT]9011issue.html2012-10-01 17:31 60K 
[TXT]9012issue.html2012-10-01 17:30 60K 
[TXT]9107issue.html2012-10-01 17:33 60K 
[TXT]9108issue.html2012-10-01 17:34 64K 
[TXT]9109issue.html2012-10-01 17:33 56K 
[TXT]9110issue.html2012-10-01 17:33 67K 
[TXT]9111issue.html2012-10-01 17:33 58K 
[TXT]9112issue.html2012-10-01 17:33 62K 
[TXT]9209issue.html2012-10-01 17:28 62K 
[TXT]9210issue.html2012-10-01 17:33 65K 
[TXT]9211issue.html2012-10-01 17:33 62K 
[TXT]9212issue.html2012-10-01 17:30 63K 
[TXT]9311issue.html2012-10-01 17:27 60K 
[TXT]9312issue.html2012-10-01 17:34 59K 
[TXT]9410issue.html2012-10-01 17:29 61K 
[TXT]9411issue.html2012-10-01 17:30 66K 
[TXT]9412issue.html2012-10-01 17:29 74K 
[   ]9501ar.pdf2012-10-01 17:33 434K 
[TXT]9510issue.html2012-10-01 17:32 79K 
[TXT]9511issue.html2012-10-01 17:31 81K 
[TXT]9512issue.html2012-10-01 17:33 77K 
[TXT]9610issue.html2012-10-01 17:32 74K 
[TXT]9611issue.html2012-10-01 17:32 79K 
[TXT]9612issue.html2012-10-01 17:32 80K 
[TXT]9710issue.html2012-10-01 17:32 82K 
[TXT]9711issue.html2012-10-01 17:32 81K 
[TXT]9712issue.html2012-10-01 17:31 105K 
[TXT]9778issue.html2012-10-01 17:28 173K 
[TXT]9810issue.html2012-10-01 17:30 75K 
[TXT]9811issue.html2012-10-01 17:32 74K 
[TXT]9812issue.html2012-10-01 17:27 75K 
[TXT]9910issue.html2012-10-01 17:32 77K 
[TXT]9911issue.html2012-10-01 17:29 80K 
[TXT]9912issue.html2012-10-01 17:34 100K 
[   ]41839.web.pdf2012-10-01 17:32 11K 
[TXT]45777355.html2012-10-01 17:28 31K 
[TXT]ABC Targets White Children.htm2012-10-01 17:29 7.6K 
[DIR]ABC Targets White Children_files/2015-10-04 18:43 -  
[TXT]ACLU Top Heavy with Jews.htm2012-10-01 17:27 6.8K 
[DIR]ACLU Top Heavy with Jews_files/2015-10-04 18:43 -  
[TXT]ADL's Foxman - New Testament is Anti-Semitic.htm2012-10-01 17:28 2.4K 
[DIR]ADL's Foxman - New Testament is Anti-Semitic_files/2015-10-04 18:43 -  
[TXT]ADL Anti-Defamation League of B'nai B'rith conducts smear campaigns - ADL Anti-Defamation League of B'nai B'rith is caught in cover-up of its crimes.htm2012-10-01 17:34 57K 
[DIR]ADL Anti-Defamation League of B'nai B'rith conducts smear campaigns - ADL Anti-Defamation League of B'nai B'rith is caught in cover-up of its crimes_files/2015-10-04 18:43 -  
[TXT]ADL Briefs U.S. House on Internet 'Hate'.htm2012-10-01 17:33 3.5K 
[DIR]ADL Briefs U.S. House on Internet 'Hate'_files/2015-10-04 18:43 -  
[TXT]ADL Champions Gay Marriage, Calls Opponents 'Ugly Bigots'.htm2012-10-01 17:31 2.7K 
[TXT]ADL Demands Gulag for Dissenters.htm2012-10-01 17:34 3.5K 
[DIR]ADL Demands Gulag for Dissenters_files/2015-10-04 18:43 -  
[TXT]ADL Führer Warns of 'Intermarriage' and Public Schooling.htm2012-10-01 17:28 5.5K 
[DIR]ADL Führer Warns of 'Intermarriage' and Public Schooling_files/2015-10-04 18:43 -  
[TXT]ADL Opponents Officially Designated As 'Terrorist Organizations'.htm2012-10-01 17:27 6.5K 
[DIR]ADL Opponents Officially Designated As 'Terrorist Organizations'_files/2015-10-04 18:43 -  
[TXT]A Date with Bevin.htm2012-10-01 17:28 4.1K 
[DIR]A Date with Bevin_files/2015-10-04 18:43 -  
[TXT]A Great Day in L.A..htm2012-10-01 17:31 9.5K 
[DIR]A Great Day in L.A._files/2015-10-04 18:43 -  
[TXT]A Group of Friends - Magnet For A Lonely America.htm2012-10-01 17:33 6.8K 
[DIR]A Group of Friends - Magnet For A Lonely America_files/2015-10-04 18:43 -  
[TXT]AIDS Alert! Avoid Sugar Daddies!.htm2012-10-01 17:33 2.3K 
[DIR]AIDS Alert! Avoid Sugar Daddies!_files/2015-10-04 18:43 -  
[TXT]AIDS Epidemic Among Black Elite.htm2012-10-01 17:33 3.2K 
[DIR]AIDS Epidemic Among Black Elite_files/2015-10-04 18:43 -  
[TXT]AIPAC, the Religious Right and American Foreign Policy.htm2012-10-01 17:28 34K 
[TXT]AIPAC Congratulates Itself on the Slaughter in Lebanon.htm2012-10-01 17:33 3.1K 
[DIR]AIPAC Congratulates Itself on the Slaughter in Lebanon_files/2015-10-04 18:43 -  
[TXT]AIPAC Espionage Case Dismissal Gambit Fails.htm2012-10-01 17:31 3.6K 
[DIR]AIPAC Espionage Case Dismissal Gambit Fails_files/2015-10-04 18:43 -  
[TXT]AIPAC Scandal Breaks Loose.htm2012-10-01 17:29 2.6K 
[DIR]AIPAC Scandal Breaks Loose_files/2015-10-04 18:43 -  
[TXT]AIPAC Warns Dems Not to Appear at Anti-war Demo.htm2012-10-01 17:30 2.8K 
[DIR]AIPAC Warns Dems Not to Appear at Anti-war Demo_files/2015-10-04 18:43 -  
[TXT]A Look Back at Revisionism.htm2012-10-01 17:27 116K 
[DIR]A Look Back at Revisionism_files/2015-10-04 18:43 -  
[TXT]AMAZING ISSUE WITH TARGET.TXT2012-10-01 17:28 1.9K 
[TXT]A Man Named Arkan.htm2012-10-01 17:30 8.8K 
[DIR]A Man Named Arkan_files/2015-10-04 18:43 -  
[TXT]A Mile Too Far.htm2012-10-01 17:33 26K 
[DIR]A Mile Too Far_files/2015-10-04 18:43 -  
[TXT]A Minuteman Boosts Border Overhaul Reform.htm2012-10-01 17:30 4.7K 
[DIR]A Minuteman Boosts Border Overhaul Reform_files/2015-10-04 18:43 -  
[TXT]A National Emergency.htm2012-10-01 17:28 2.4K 
[DIR]A National Emergency_files/2015-10-04 18:43 -  
[TXT]A New Commission for a New Era.htm2012-10-01 17:32 2.9K 
[DIR]A New Commission for a New Era_files/2015-10-04 18:43 -  
[TXT]A Once Great Britain.htm2012-10-01 17:30 7.2K 
[DIR]A Once Great Britain_files/2015-10-04 18:43 -  
[   ]AP.pdf2012-10-01 17:29 201K 
[   ]AP.rtf2012-10-01 17:31 247K 
[TXT]AP In Hurricane 'Moral Equivalency' Hassle.htm2012-10-01 17:28 4.9K 
[DIR]AP In Hurricane 'Moral Equivalency' Hassle_files/2015-10-04 18:43 -  
[TXT]AP Interviews Geert Wilders.htm2012-10-01 17:33 3.2K 
[DIR]AP Interviews Geert Wilders_files/2015-10-04 18:43 -  
[TXT]AR2006041001423_pf.html2012-10-01 17:33 12K 
[TXT]AR2006041200149.html2012-10-01 17:31 67K 
[TXT]AR2006041200477.html2012-10-01 17:33 72K 
[TXT]A Split In the Racist Right.htm2012-10-01 17:32 21K 
[DIR]A Split In the Racist Right_files/2015-10-04 18:43 -  
[TXT]A V-Reader Gives Belgians a Message.htm2012-10-01 17:28 3.7K 
[DIR]A V-Reader Gives Belgians a Message_files/2015-10-04 18:43 -  
[TXT]A White College Student's Guide to Political Activism.htm2012-10-01 17:27 30K 
[TXT]A White Future is Coming - an interview with Bob Whitaker.htm2012-10-01 17:30 27K 
[DIR]A White Future is Coming - an interview with Bob Whitaker_files/2015-10-04 18:43 -  
[TXT]A White Majority For New Orleans.htm2012-10-01 17:31 4.0K 
[DIR]A White Majority For New Orleans_files/2015-10-04 18:43 -  
[TXT]Abandoned Gold Standard Guarantees Inflation.htm2012-10-01 17:31 15K 
[DIR]Abandoned Gold Standard Guarantees Inflation_files/2015-10-04 18:43 -  
[TXT]Abandoned and Betrayed.htm2012-10-01 17:30 5.3K 
[DIR]Abandoned and Betrayed_files/2015-10-04 18:43 -  
[TXT]Accused Negro Sniper to 'Question' His White Victim.htm2012-10-01 17:31 1.8K 
[DIR]Accused Negro Sniper to 'Question' His White Victim_files/2015-10-04 18:43 -  
[TXT]Adorno's Bastards and the Frankfurt School.htm2012-10-01 17:32 53K 
[DIR]Adorno's Bastards and the Frankfurt School_files/2015-10-04 18:43 -  
[TXT]Ads Declare Population Driven Environmental Crisis In California.htm2012-10-01 17:30 4.2K 
[DIR]Ads Declare Population Driven Environmental Crisis In California_files/2015-10-04 18:43 -  
[TXT]Advice on building an electric car for those interested.htm2012-10-01 17:31 96K 
[DIR]Advice on building an electric car for those interested_files/2015-10-04 18:43 -  
[TXT]Africa In Our Midst - Lessons From Katrina.htm2012-10-01 17:31 3.1K 
[DIR]Africa In Our Midst - Lessons From Katrina_files/2015-10-04 18:43 -  
[TXT]African 'Culture' Spreads HIV.htm2012-10-01 17:32 3.4K 
[DIR]African 'Culture' Spreads HIV_files/2015-10-04 18:43 -  
[TXT]After Millennia in India, Lost Tribe Returns to Israel.htm2012-10-01 17:31 3.9K 
[DIR]After Millennia in India, Lost Tribe Returns to Israel_files/2015-10-04 18:43 -  
[   ]AgentProvocateur.pdf2012-10-01 17:33 6.8K 
[TXT]Agitprop.htm2012-10-01 17:31 4.8K 
[DIR]Agitprop_files/2015-10-04 18:43 -  
[TXT]Alabama - Immigrants Make School Rolls Larger than Town.htm2012-10-01 17:33 3.1K 
[DIR]Alabama - Immigrants Make School Rolls Larger than Town_files/2015-10-04 18:43 -  
[TXT]Alan Stang - 2004-01-16 - 'Martin Luther' King - Communist Fraud.htm2012-10-01 17:28 27K 
[DIR]Alan Stang - 2004-01-16 - 'Martin Luther' King - Communist Fraud_files/2015-10-04 18:43 -  
[TXT]Ali G Worries ADL.htm2012-10-01 17:33 2.6K 
[DIR]Ali G Worries ADL_files/2015-10-04 18:43 -  
[TXT]Alleged Racial-Beating Victim Admits Concocting Story.htm2012-10-01 17:29 3.9K 
[DIR]Alleged Racial-Beating Victim Admits Concocting Story_files/2015-10-04 18:43 -  
[TXT]Alpin MacLaren - 2006-01-06 - Cold Turkey - Multiracialism is destroying our schools.htm2012-10-01 17:27 22K 
[DIR]Alpin MacLaren - 2006-01-06 - Cold Turkey - Multiracialism is destroying our schools_files/2015-10-04 18:43 -  
[TXT]Alpin MacLaren - 2006-02-09 - Civil Wrongs.htm2012-10-01 17:31 22K 
[DIR]Alpin MacLaren - 2006-02-09 - Civil Wrongs_files/2015-10-04 18:43 -  
[TXT]Alpin MacLaren - 2006-03-02 - When Logic Fails.htm2012-10-01 17:31 8.9K 
[DIR]Alpin MacLaren - 2006-03-02 - When Logic Fails_files/2015-10-04 18:43 -  
[TXT]America's Middle Class Shrinking in Globalist Economy.htm2012-10-01 17:31 2.8K 
[DIR]America's Middle Class Shrinking in Globalist Economy_files/2015-10-04 18:43 -  
[TXT]America's Most Powerful Hate Group.htm2012-10-01 17:31 14K 
[DIR]America's Most Powerful Hate Group_files/2015-10-04 18:43 -  
[TXT]America Disappearing.htm2012-10-01 17:28 3.2K 
[DIR]America Disappearing_files/2015-10-04 18:43 -  
[TXT]America Firster Jew Exposes Israel and the Zionist Network.htm2012-10-01 17:34 87K 
[DIR]America Firster Jew Exposes Israel and the Zionist Network_files/2015-10-04 18:43 -  
[   ]American Literature Sequence.pdf2012-10-01 17:28 482K 
[TXT]Americans Say Enough is Enough! Miller Beer Boycott Update.htm2012-10-01 17:28 10K 
[DIR]Americans Say Enough is Enough! Miller Beer Boycott Update_files/2015-10-04 18:43 -  
[   ]Amerika Text Uploads.sit2012-10-01 17:33 489K 
[TXT]Amid Katrina Chaos, Congressman Used National Guard to Visit Home.htm2012-10-01 17:33 3.2K 
[DIR]Amid Katrina Chaos, Congressman Used National Guard to Visit Home_files/2015-10-04 18:43 -  
[TXT]Anarcho-Tyranny—Where Multiculturalism Leads.htm2012-10-01 17:29 7.0K 
[DIR]Anarcho-Tyranny—Where Multiculturalism Leads_files/2015-10-04 18:43 -  
[TXT]Andrew Young Pulls a 'Mel Gibson'.htm2012-10-01 17:32 4.6K 
[DIR]Andrew Young Pulls a 'Mel Gibson'_files/2015-10-04 18:43 -  
[   ]AnimalFarm.pdf2012-10-01 17:30 225K 
[   ]AnneFrankFraud.pdf2012-10-01 17:31 111K 
[TXT]Another Anti-White Race-Hate Murder Ignored by National Media.htm2012-10-01 17:28 6.2K 
[TXT]Anti-Child-Molester Protest Stopped by 'Anti-Fascist Action'.htm2012-10-01 17:27 3.0K 
[DIR]Anti-Child-Molester Protest Stopped by 'Anti-Fascist Action'_files/2015-10-04 18:43 -  
[TXT]Anti-White Discrimination Plagues European Art Scene.htm2012-10-01 17:33 2.9K 
[DIR]Anti-White Discrimination Plagues European Art Scene_files/2015-10-04 18:43 -  
[   ]Anti-White Hate Crimes.rtf2012-10-01 17:30 18K 
[TXT]Anti-White Quotes.txt2012-10-01 17:28 12K 
[   ]AntiHumans.pdf2012-10-01 17:31 600K 
[TXT]Apartheid State of Israel Expands Colonization of Golan Heights.htm2012-10-01 17:27 3.9K 
[DIR]Apartheid State of Israel Expands Colonization of Golan Heights_files/2015-10-04 18:43 -  
[TXT]Apocalypse at Dresden - The Worst Massacre in the History of the World.htm2012-10-01 17:32 39K 
[DIR]Apocalypse at Dresden - The Worst Massacre in the History of the World_files/2015-10-04 18:43 -  
[TXT]Apparent Drug Overdose Claims Life of National Vanguard Foe.htm2012-10-01 17:34 3.4K 
[DIR]Apparent Drug Overdose Claims Life of National Vanguard Foe_files/2015-10-04 18:43 -  
[   ]Apr01.pdf2012-10-01 17:33 1.1M 
[   ]Apr02.pdf2012-10-01 17:28 1.4M 
[   ]Apr03.pdf2012-10-01 17:29 1.0M 
[   ]Apr04.pdf2012-10-01 17:32 1.2M 
[   ]Apr05-1.pdf2012-10-01 17:33 637K 
[TXT]April 30, 1863 - The Battle of Camarón.htm2012-10-01 17:31 8.9K 
[   ]Ar-fly.pdf2012-10-01 17:34 114K 
[TXT]Arabs and Slave Trade.htm2012-10-01 17:28 11K 
[   ]AreJewsARace.pdf2012-10-01 17:31 464K 
[TXT]A review of La convergence des catastrophes by Guillaume Corvus.htm2012-10-01 17:30 47K 
[DIR]A review of La convergence des catastrophes by Guillaume Corvus_files/2015-10-04 18:43 -  
[TXT]Arm Against 'Katricians,' Gun Dealers Tell Houston.htm2012-10-01 17:31 53K 
[DIR]Arm Against 'Katricians,' Gun Dealers Tell Houston_files/2015-10-04 18:43 -  
[   ]ArmingAmericaFraud.pdf2012-10-01 17:27 28K 
[TXT]Artful Anecdotes.htm2012-10-01 17:28 7.1K 
[DIR]Artful Anecdotes_files/2015-10-04 18:43 -  
[TXT]Asians Murder British Lad for Being White.htm2012-10-01 17:28 2.9K 
[DIR]Asians Murder British Lad for Being White_files/2015-10-04 18:43 -  
[TXT]Assassination Attempt on David Duke.htm2012-10-01 17:29 4.6K 
[DIR]Assassination Attempt on David Duke_files/2015-10-04 18:43 -  
[TXT]Assault Arrest Followed Word to Cheney.htm2012-10-01 17:33 2.8K 
[DIR]Assault Arrest Followed Word to Cheney_files/2015-10-04 18:43 -  
[TXT]At Least 5 Killed By Police In New Orleans (Bad Guys Killed-Not Contractors).htm2012-10-01 17:31 63K 
[TXT]A theory of Einstein the irrational plagiarist.htm2012-10-01 17:31 40K 
[DIR]A theory of Einstein the irrational plagiarist_files/2015-10-04 18:43 -  
[   ]Aug01.pdf2012-10-01 17:28 656K 
[   ]Aug02.pdf2012-10-01 17:30 1.7M 
[   ]Aug03.pdf2012-10-01 17:31 612K 
[   ]Aug04.pdf2012-10-01 17:31 671K 
[TXT]August 23, 1917 - Black Mutiny Leaves 16 Whites Dead.htm2012-10-01 17:27 5.4K 
[DIR]August 23, 1917 - Black Mutiny Leaves 16 Whites Dead_files/2015-10-04 18:43 -  
[   ]AussieNationalism.pdf2012-10-01 17:31 1.1M 
[TXT]Australia - Rape Gangs and Multiracialism.htm2012-10-01 17:33 11K 
[DIR]Australia - Rape Gangs and Multiracialism_files/2015-10-04 18:43 -  
[TXT]Austrian court confirms British historian guilty of Holocaust denial.htm2012-10-01 17:33 4.8K 
[DIR]Austrian court confirms British historian guilty of Holocaust denial_files/2015-10-04 18:43 -  
[TXT]Austrians Fed Up With Kosher Arnie.htm2012-10-01 17:32 4.4K 
[DIR]Austrians Fed Up With Kosher Arnie_files/2015-10-04 18:43 -  
[TXT]Autumnal Equinox Comes.htm2012-10-01 17:33 4.2K 
[DIR]Autumnal Equinox Comes_files/2015-10-04 18:43 -  
[   ]AvoidAIDS.pdf2012-10-01 17:28 261K 
[TXT]Avoid Mestizos - AIDS Rampant Among Mestizos.htm2012-10-01 17:33 2.0K 
[DIR]Avoid Mestizos - AIDS Rampant Among Mestizos_files/2015-10-04 18:43 -  
[TXT]Axe Wielding Albanian Mob Brutally Assaults Elderly Serb Couple in Kosovo.htm2012-10-01 17:30 2.8K 
[DIR]Axe Wielding Albanian Mob Brutally Assaults Elderly Serb Couple in Kosovo_files/2015-10-04 18:43 -  
[TXT]Aztecs Butchered, Ate Prisoners.htm2012-10-01 17:27 3.5K 
[DIR]Aztecs Butchered, Ate Prisoners_files/2015-10-04 18:43 -  
[   ]B&H Field Manual.pdf2012-10-01 17:31 301K 
[TXT]BBC To Report On London Kabbalah Center.htm2012-10-01 17:30 13K 
[DIR]BBC To Report On London Kabbalah Center_files/2015-10-04 18:43 -  
[TXT]BNP's Griffin - Asians Engage in Ethnic Cleansing in Oldham.htm2012-10-01 17:28 3.7K 
[TXT]BNP Gets Voice on Yorkshire Race Council.htm2012-10-01 17:30 4.9K 
[DIR]BNP Gets Voice on Yorkshire Race Council_files/2015-10-04 18:43 -  
[TXT]BNP Leader Affirms - Islam 'Wicked' Faith.htm2012-10-01 17:31 4.5K 
[DIR]BNP Leader Affirms - Islam 'Wicked' Faith_files/2015-10-04 18:43 -  
[TXT]Background on the Jewish Defense Organization.htm2012-10-01 17:33 2.9K 
[DIR]Background on the Jewish Defense Organization_files/2015-10-04 18:43 -  
[TXT]Back to...Homeschool.htm2012-10-01 17:27 3.1K 
[DIR]Back to...Homeschool_files/2015-10-04 18:43 -  
[TXT]Ban-Crazy Brits Nix St. George Again.htm2012-10-01 17:33 3.1K 
[DIR]Ban-Crazy Brits Nix St. George Again_files/2015-10-04 18:43 -  
[TXT]Baton Rouge Whites Mob Gun Stores.htm2012-10-01 17:32 5.1K 
[DIR]Baton Rouge Whites Mob Gun Stores_files/2015-10-04 18:43 -  
[   ]BeastAsSaint.pdf2012-10-01 17:30 136K 
[   ]BeastAsSaintNew.pdf2012-10-01 17:33 77K 
[TXT]Beauty, Art, and Race.htm2012-10-01 17:31 20K 
[DIR]Beauty, Art, and Race_files/2015-10-04 18:43 -  
[TXT]Behind the Mask of Respectability - The truth about the Anti-Defamation League of B'nai B'rith.htm2012-10-01 17:29 14K 
[DIR]Behind the Mask of Respectability - The truth about the Anti-Defamation League of B'nai B'rith_files/2015-10-04 18:43 -  
[TXT]Belgian Police Raid Revisionists.htm2012-10-01 17:30 3.3K 
[DIR]Belgian Police Raid Revisionists_files/2015-10-04 18:43 -  
[TXT]Belgium - Multicultural Fascism Now Official Policy.htm2012-10-01 17:29 6.4K 
[DIR]Belgium - Multicultural Fascism Now Official Policy_files/2015-10-04 18:43 -  
[TXT]Beloved Wagnerian Soprano Passes.htm2012-10-01 17:34 3.6K 
[DIR]Beloved Wagnerian Soprano Passes_files/2015-10-04 18:43 -  
[TXT]Benedict Meets with Dissident Journalist.htm2012-10-01 17:31 3.3K 
[DIR]Benedict Meets with Dissident Journalist_files/2015-10-04 18:43 -  
[TXT]Benedict to Meet with Traditionalists.htm2012-10-01 17:28 4.4K 
[DIR]Benedict to Meet with Traditionalists_files/2015-10-04 18:43 -  
[TXT]Bergen's Lie.htm2012-10-01 17:33 3.0K 
[DIR]Bergen's Lie_files/2015-10-04 18:43 -  
[TXT]Between the Jews and the Gentiles -- In the Aggadah, the Kabbalah, and in Jewish Thought.htm2012-10-01 17:33 61K 
[DIR]Between the Jews and the Gentiles -- In the Aggadah, the Kabbalah, and in Jewish Thought_files/2015-10-04 18:43 -  
[   ]Bevier Pamphlet JR.pdf2012-10-01 17:31 208K 
[   ]Bevier_pamphlet.doc2012-10-01 17:32 177K 
[TXT]Beyonce - 'I Make Black Records'.htm2012-10-01 17:32 2.7K 
[DIR]Beyonce - 'I Make Black Records'_files/2015-10-04 18:43 -  
[TXT]Beyond Chutzpah.htm2012-10-01 17:33 32K 
[DIR]Beyond Chutzpah_files/2015-10-04 18:43 -  
[   ]BibleTalmudQuotes.pdf2012-10-01 17:33 107K 
[TXT]Bill White - 2006-03-27 - National Socialism And The Klan.txt2012-10-01 17:33 19K 
[TXT]Birmingham Riots - Color is Only Skin Deep.htm2012-10-01 17:31 4.0K 
[DIR]Birmingham Riots - Color is Only Skin Deep_files/2015-10-04 18:43 -  
[TXT]Black 'Jews' Accused in Israeli Welfare Scam.htm2012-10-01 17:29 6.3K 
[DIR]Black 'Jews' Accused in Israeli Welfare Scam_files/2015-10-04 18:43 -  
[TXT]Black Columnis - National Alliance Put Issue of Interracial Sex 'Out There'.htm2012-10-01 17:31 1.7K 
[TXT]Black Ex-Crack Salesman to Launch 'Books'.htm2012-10-01 17:33 4.5K 
[DIR]Black Ex-Crack Salesman to Launch 'Books'_files/2015-10-04 18:43 -  
[TXT]Black God Begs Devil for Dignified Demise.htm2012-10-01 17:31 5.8K 
[DIR]Black God Begs Devil for Dignified Demise_files/2015-10-04 18:43 -  
[TXT]Black HUD Chief Foresees a 'Whiter' New Orleans.htm2012-10-01 17:29 4.0K 
[DIR]Black HUD Chief Foresees a 'Whiter' New Orleans_files/2015-10-04 18:43 -  
[   ]BlackInnovation.pdf2012-10-01 17:27 15K 
[TXT]Black Leaders and the Demise of the OIC.htm2012-10-01 17:30 15K 
[DIR]Black Leaders and the Demise of the OIC_files/2015-10-04 18:43 -  
[TXT]Black Muslim Update - Oakland Store Arab Kidnapped.htm2012-10-01 17:32 5.6K 
[DIR]Black Muslim Update - Oakland Store Arab Kidnapped_files/2015-10-04 18:43 -  
[TXT]Black Panther Foundation Seeks to Sell 'Burn Baby Burn' Hot Sauce.htm2012-10-01 17:32 2.3K 
[DIR]Black Panther Foundation Seeks to Sell 'Burn Baby Burn' Hot Sauce_files/2015-10-04 18:43 -  
[TXT]Black Panthers Jailed in Cop-Killing Probe.htm2012-10-01 17:34 2.9K 
[DIR]Black Panthers Jailed in Cop-Killing Probe_files/2015-10-04 18:43 -  
[TXT]Black Rap Star Caught Using Sweat Shop Slaves.htm2012-10-01 17:31 1.7K 
[TXT]Black Refugee Accused of Raping Retarded Girl.htm2012-10-01 17:30 3.4K 
[DIR]Black Refugee Accused of Raping Retarded Girl_files/2015-10-04 18:43 -  
[   ]BlackSlaveOwners.pdf2012-10-01 17:31 22K 
[   ]BlackSlaveOwners.rtf2012-10-01 17:31 33K 
[TXT]Black Supremacist Relies on White Science to Stay Alive.htm2012-10-01 17:32 3.5K 
[TXT]Black US Employees Accused of Slave-driving in Africa.htm2012-10-01 17:33 3.8K 
[DIR]Black US Employees Accused of Slave-driving in Africa_files/2015-10-04 18:43 -  
[TXT]Black Vikings Fumble 'Ethics'.htm2012-10-01 17:32 7.4K 
[DIR]Black Vikings Fumble 'Ethics'_files/2015-10-04 18:43 -  
[TXT]Blackness Tells It Like It Be.htm2012-10-01 17:28 5.0K 
[DIR]Blackness Tells It Like It Be_files/2015-10-04 18:43 -  
[TXT]Blacks on New Orleans Looting Rampage.htm2012-10-01 17:28 5.3K 
[DIR]Blacks on New Orleans Looting Rampage_files/2015-10-04 18:43 -  
[   ]Bloggers_Handbook2.pdf2012-10-01 17:28 3.5M 
[TXT]Blood on the Frost - Never Forget the Hmong Massacre.htm2012-10-01 17:30 23K 
[DIR]Blood on the Frost - Never Forget the Hmong Massacre_files/2015-10-04 18:43 -  
[TXT]Bombs and Hurricanes - Our Struggle.htm2012-10-01 17:31 3.7K 
[DIR]Bombs and Hurricanes - Our Struggle_files/2015-10-04 18:43 -  
[TXT]Boycott Miller for Supporting Illegal Aliens and Illegal Immigration.htm2012-10-01 17:32 4.1K 
[DIR]Boycott Miller for Supporting Illegal Aliens and Illegal Immigration_files/2015-10-04 18:43 -  
[TXT]Brann - THE BUCK NEGRO.htm2012-10-01 17:27 13K 
[TXT]Brigham Young's Speech on Slavery, blacks and the Priesthood.htm2012-10-01 17:33 17K 
[DIR]Brigham Young's Speech on Slavery, blacks and the Priesthood_files/2015-10-04 18:43 -  
[TXT]Britain’s Racial Diversity Brings Murder; No Justice.htm2012-10-01 17:28 3.0K 
[DIR]Britain’s Racial Diversity Brings Murder; No Justice_files/2015-10-04 18:43 -  
[TXT]Britain Recruited Muslim Terrorists.htm2012-10-01 17:27 3.0K 
[DIR]Britain Recruited Muslim Terrorists_files/2015-10-04 18:43 -  
[TXT]Britons Pay Price for Neo-Con Madness.htm2012-10-01 17:27 3.4K 
[DIR]Britons Pay Price for Neo-Con Madness_files/2015-10-04 18:43 -  
[TXT]Briton tells of Katrina nightmare.htm2012-10-01 17:29 6.4K 
[DIR]Briton tells of Katrina nightmare_files/2015-10-04 18:43 -  
[TXT]Brooklyn-Based Jew Admits to Trafficking in Women.htm2012-10-01 17:32 4.0K 
[DIR]Brooklyn-Based Jew Admits to Trafficking in Women_files/2015-10-04 18:43 -  
[TXT]Brooklyn - Black 'Students' Charged With Anti-White Race Attack.htm2012-10-01 17:28 2.5K 
[DIR]Brooklyn - Black 'Students' Charged With Anti-White Race Attack_files/2015-10-04 18:43 -  
[TXT]Brooklyn Jew Ritually Murders Chickens.htm2012-10-01 17:33 2.1K 
[DIR]Brooklyn Jew Ritually Murders Chickens_files/2015-10-04 18:43 -  
[   ]BruderFlyer.pdf2012-10-01 17:30 91K 
[   ]BugChasers.pdf2012-10-01 17:32 58K 
[TXT]Bush - It's All About the Spin.htm2012-10-01 17:31 2.8K 
[DIR]Bush - It's All About the Spin_files/2015-10-04 18:43 -  
[TXT]Bush Buddy in Flap over Jewish 'Holy Water'.htm2012-10-01 17:31 3.9K 
[DIR]Bush Buddy in Flap over Jewish 'Holy Water'_files/2015-10-04 18:43 -  
[TXT]Bush Speech Gave Race Hustlers Fresh Ammo.htm2012-10-01 17:31 3.1K 
[DIR]Bush Speech Gave Race Hustlers Fresh Ammo_files/2015-10-04 18:43 -  
[TXT]By Way Of Deception.htm2012-10-01 17:29 29K 
[DIR]By Way Of Deception_files/2015-10-04 18:43 -  
[TXT]By way of deception thou shalt do war.htm2012-10-01 17:30 39K 
[DIR]By way of deception thou shalt do war_files/2015-10-04 18:43 -  
[   ]CISReport.pdf2012-10-01 17:30 221K 
[   ]CLARITY.pdf2012-10-01 17:31 88K 
[TXT]COLOR COMMUNISM AND COMMON SENSE.txt2012-10-01 17:34 75K 
[TXT]California - April Gaede Awarded Queen Isabella Prize.htm2012-10-01 17:34 2.9K 
[DIR]California - April Gaede Awarded Queen Isabella Prize_files/2015-10-04 18:43 -  
[TXT]California - Minuteman Won Election Day Vote.htm2012-10-01 17:31 7.0K 
[DIR]California - Minuteman Won Election Day Vote_files/2015-10-04 18:43 -  
[TXT]California - Pro-White Music At Folk The System.htm2012-10-01 17:29 10K 
[DIR]California - Pro-White Music At Folk The System_files/2015-10-04 18:43 -  
[TXT]California - Tookie's Son on the Run.htm2012-10-01 17:33 3.4K 
[DIR]California - Tookie's Son on the Run_files/2015-10-04 18:43 -  
[TXT]California - Tookie Executed.htm2012-10-01 17:32 2.6K 
[DIR]California - Tookie Executed_files/2015-10-04 18:43 -  
[TXT]California Initiative for State Border Police Gaining Ground.htm2012-10-01 17:32 4.7K 
[DIR]California Initiative for State Border Police Gaining Ground_files/2015-10-04 18:43 -  
[   ]Camp of the Saints.pdf2012-10-01 17:28 18K 
[TXT]Can 'Liberals' Be Educated.htm2012-10-01 17:33 45K 
[DIR]Can 'Liberals' Be Educated_files/2015-10-04 18:43 -  
[   ]Canadian Heritage Alliance Articles Letters to Newspapers .doc2012-10-01 17:30 23K 
[TXT]Cannibalism in the African Congo.htm2012-10-01 17:33 13K 
[DIR]Cannibalism in the African Congo_files/2015-10-04 18:43 -  
[TXT]Cans of Paint, Two White Halves, and Chromosomes.htm2012-10-01 17:31 9.4K 
[DIR]Cans of Paint, Two White Halves, and Chromosomes_files/2015-10-04 18:43 -  
[   ]CarrsTestimony.pdf2012-10-01 17:34 121K 
[   ]CarrsTestimony.rtf2012-10-01 17:29 238K 
[TXT]Catastrophe In Kansas City.htm2012-10-01 17:34 35K 
[TXT]Catholic Leaders Condemn Anti-Zionism.htm2012-10-01 17:31 3.9K 
[   ]CattleRaidOfCooley.pdf2012-10-01 17:33 1.2M 
[TXT]Challenging the Power of the Jewish Lobby - What Should Be Done.htm2012-10-01 17:33 22K 
[DIR]Challenging the Power of the Jewish Lobby - What Should Be Done_files/2015-10-04 18:43 -  
[TXT]Challenging the Power of the Jewish Lobby.htm2012-10-01 17:30 6.6K 
[DIR]Challenging the Power of the Jewish Lobby_files/2015-10-04 18:43 -  
[TXT]Chapt_01.htm2012-10-01 17:31 14K 
[TXT]Chapt_02.htm2012-10-01 17:33 32K 
[TXT]Chapt_03.htm2012-10-01 17:31 28K 
[TXT]Chapt_04.htm2012-10-01 17:31 31K 
[TXT]Chapt_05.htm2012-10-01 17:33 18K 
[TXT]Chapt_06.htm2012-10-01 17:33 63K 
[TXT]Chapt_07.htm2012-10-01 17:33 43K 
[TXT]Chapt_08.htm2012-10-01 17:31 19K 
[TXT]Chapt_09.htm2012-10-01 17:30 46K 
[TXT]Chapt_10.htm2012-10-01 17:27 41K 
[TXT]Chapt_11.htm2012-10-01 17:28 22K 
[TXT]Chapt_12.htm2012-10-01 17:31 27K 
[TXT]Chapt_13.htm2012-10-01 17:27 32K 
[TXT]Chapt_14.htm2012-10-01 17:31 36K 
[TXT]Chapt_15.htm2012-10-01 17:33 19K 
[TXT]Chapt_16.htm2012-10-01 17:28 7.8K 
[TXT]Chavez Condemned for 'Anti-Semitism'.htm2012-10-01 17:32 2.8K 
[DIR]Chavez Condemned for 'Anti-Semitism'_files/2015-10-04 18:43 -  
[TXT]Cherishing an Older Catholicism.htm2012-10-01 17:32 2.5K 
[DIR]Cherishing an Older Catholicism_files/2015-10-04 18:43 -  
[TXT]Chertoff Aide Guilty in Child Porn Case.htm2012-10-01 17:31 5.2K 
[DIR]Chertoff Aide Guilty in Child Porn Case_files/2015-10-04 18:43 -  
[TXT]Chertoff Claims He Didn't Have A Clue.htm2012-10-01 17:30 5.8K 
[DIR]Chertoff Claims He Didn't Have A Clue_files/2015-10-04 18:43 -  
[TXT]Chertoff Proposes Non-Profit Spying Group.htm2012-10-01 17:33 2.4K 
[DIR]Chertoff Proposes Non-Profit Spying Group_files/2015-10-04 18:43 -  
[TXT]Chertoff Timeline.htm2012-10-01 17:30 10K 
[DIR]Chertoff Timeline_files/2015-10-04 18:43 -  
[TXT]Children - National Treasure or Personal Luxury Item.htm2012-10-01 17:29 3.9K 
[DIR]Children - National Treasure or Personal Luxury Item_files/2015-10-04 18:43 -  
[TXT]China, Deflation And The Dollar.htm2012-10-01 17:27 33K 
[DIR]China, Deflation And The Dollar_files/2015-10-04 18:43 -  
[TXT]China Replaces U.S. As World's Largest Exporter.htm2012-10-01 17:31 6.4K 
[DIR]China Replaces U.S. As World's Largest Exporter_files/2015-10-04 18:43 -  
[   ]ChinaStealsUSMilitarySecrets.pdf2012-10-01 17:28 640K 
[TXT]Chosen for Pornography.htm2012-10-01 17:27 2.6K 
[DIR]Chosen for Pornography_files/2015-10-04 18:43 -  
[TXT]Christian Colleges Offer Free Tuition to Katrina Refugees.htm2012-10-01 17:28 3.8K 
[DIR]Christian Colleges Offer Free Tuition to Katrina Refugees_files/2015-10-04 18:43 -  
[TXT]Christian Leaders Urge Third World Flood.htm2012-10-01 17:30 2.6K 
[TXT]Christians in Jerusalem Want Jews to Stop Spitting on Them.htm2012-10-01 17:30 3.9K 
[DIR]Christians in Jerusalem Want Jews to Stop Spitting on Them_files/2015-10-04 18:43 -  
[TXT]Church asks evacuee to leave.htm2012-10-01 17:30 9.3K 
[DIR]Church asks evacuee to leave_files/2015-10-04 18:43 -  
[TXT]Church fighting IRS over anti-war sermon won't give up documents.htm2012-10-01 17:28 8.6K 
[DIR]Church fighting IRS over anti-war sermon won't give up documents_files/2015-10-04 18:43 -  
[DIR]Churchill's War/2015-10-04 18:43 -  
[TXT]Chutzpah - Zionists Running Anti-Slavery Organization.htm2012-10-01 17:28 13K 
[DIR]Chutzpah - Zionists Running Anti-Slavery Organization_files/2015-10-04 18:43 -  
[   ]CitizensInformerWinter2005 - Small.pdf2012-10-01 17:31 2.6M 
[   ]CivilDisobedience.pdf2012-10-01 17:31 88K 
[TXT]Civil War in Europe.htm2012-10-01 17:31 5.4K 
[DIR]Civil War in Europe_files/2015-10-04 18:43 -  
[   ]CofCCguide.pdf2012-10-01 17:30 49K 
[   ]ColorOfCrime.pdf2012-10-01 17:31 408K 
[TXT]Colorado - 57 Refugees Have Felony Records.htm2012-10-01 17:33 2.8K 
[DIR]Colorado - 57 Refugees Have Felony Records_files/2015-10-04 18:43 -  
[   ]CompilationPresentation.pdf2012-10-01 17:27 6.3M 
[TXT]CompleteGuide.html2012-10-01 17:33 94K 
[DIR]CompleteGuide_files/2015-10-04 18:43 -  
[TXT]Confirmed - Snipers Black.htm2012-10-01 17:32 2.4K 
[DIR]Confirmed - Snipers Black_files/2015-10-04 18:43 -  
[TXT]Congressional Black Caucus Holds Press Conference.htm2012-10-01 17:33 5.3K 
[DIR]Congressional Black Caucus Holds Press Conference_files/2015-10-04 18:43 -  
[TXT]Congressman Apologizes, Denies Assaulting Mistress.htm2012-10-01 17:31 2.9K 
[DIR]Congressman Apologizes, Denies Assaulting Mistress_files/2015-10-04 18:43 -  
[TXT]Conservatives; They Refuse to Call It What It Really Is - Genocide.htm2012-10-01 17:30 19K 
[TXT]Contemporary Trotskyism.htm2012-10-01 17:31 14K 
[DIR]Contemporary Trotskyism_files/2015-10-04 18:43 -  
[TXT]Controlled Media - Forget the Facts About Katrina.htm2012-10-01 17:28 8.6K 
[DIR]Controlled Media - Forget the Facts About Katrina_files/2015-10-04 18:43 -  
[   ]ControversyOfZion.pdf2012-10-01 17:31 1.6M 
[TXT]Corrupting Our Police.htm2012-10-01 17:28 20K 
[DIR]Corrupting Our Police_files/2015-10-04 18:43 -  
[   ]Cosmotheism.pdf2012-10-01 17:30 195K 
[   ]Cosmotheism.rtf2012-10-01 17:31 64K 
[   ]CostOfIsraelToUS.pdf2012-10-01 17:33 26K 
[   ]CostOfUSMideastPolicy.pdf2012-10-01 17:34 96K 
[TXT]Court Temporarily OKs Domestic Spying.htm2012-10-01 17:28 2.6K 
[DIR]Court Temporarily OKs Domestic Spying_files/2015-10-04 18:43 -  
[TXT]Court to Tookie - No Thanks, Snitch.htm2012-10-01 17:33 4.4K 
[DIR]Court to Tookie - No Thanks, Snitch_files/2015-10-04 18:43 -  
[TXT]Covering the 'Kwa - The Inflexible, Utterly Predictable and Parody-Worthy Coverage of Race by the PressWrightCovertheKwa - 11-2005.htm2012-10-01 17:29 12K 
[   ]Cre88or.ttf2012-10-01 17:31 228K 
[   ]Creamatorium4.pdf2012-10-01 17:33 71K 
[TXT]Creaoor - index.html2012-10-01 17:29 2.0K 
[TXT]Creationism and Truth.htm2012-10-01 17:31 4.8K 
[DIR]Creationism and Truth_files/2015-10-04 18:43 -  
[TXT]Crime Cover-Up in DC.htm2012-10-01 17:34 3.2K 
[DIR]Crime Cover-Up in DC_files/2015-10-04 18:43 -  
[   ]CrimeOfOurAge.pdf2012-10-01 17:30 207K 
[TXT]Criticism is Not Hate.htm2012-10-01 17:27 9.4K 
[DIR]Criticism is Not Hate_files/2015-10-04 18:43 -  
[   ]CultureOfCritique.pdf2012-10-01 17:28 1.9M 
[TXT]Curt Maynard - 2006-07-02 - A Frank Discussion of Jewish Group Dynamics.htm2012-10-01 17:31 48K 
[DIR]Curt Maynard - 2006-07-02 - A Frank Discussion of Jewish Group Dynamics_files/2015-10-04 18:43 -  
[TXT]Czech Gets Expensive Lesson.htm2012-10-01 17:28 8.6K 
[DIR]Czech Gets Expensive Lesson_files/2015-10-04 18:43 -  
[TXT]DR Congo's atrocious secret.htm2012-10-01 17:27 19K 
[DIR]DR Congo's atrocious secret_files/2015-10-04 18:43 -  
[   ]Daddy_English.pdf2012-10-01 17:31 414K 
[TXT]Dallas Cops Nix Katrina Officers.htm2012-10-01 17:27 3.6K 
[DIR]Dallas Cops Nix Katrina Officers_files/2015-10-04 18:43 -  
[TXT]Dan Osterton - 2006-07-20 - The Necessity of Invasion.htm2012-10-01 17:31 10K 
[DIR]Dan Osterton - 2006-07-20 - The Necessity of Invasion_files/2015-10-04 18:43 -  
[TXT]Daryl Bradford Smith - Prepare for the upcoming battle.htm2012-10-01 17:29 21K 
[DIR]Daryl Bradford Smith - Prepare for the upcoming battle_files/2015-10-04 18:43 -  
[   ]David C Tate - The Cause.pdf2012-10-01 17:32 166K 
[TXT]David Daogherty - 2004-11-12 - The Little-Known World of Pro-White Music.txt2012-10-01 17:30 17K 
[TXT]David Daugherty - 2006-02-09 - Thanks, We Have Our Own Media Now.htm2012-10-01 17:30 17K 
[DIR]David Daugherty - 2006-02-09 - Thanks, We Have Our Own Media Now_files/2015-10-04 18:43 -  
[TXT]David Duke Discusses Jewish Conspiracy On MSNBC.txt2012-10-01 17:33 17K 
[   ]David Irving - 1967.pdf2012-10-01 17:27 937K 
[   ]David Irving - Apocalypse.zip2012-10-01 17:28 1.4M 
[   ]David Irving - Generals.zip2012-10-01 17:30 3.5M 
[   ]David Irving - Goebbels.pdf2012-10-01 17:33 2.9M 
[   ]David Irving - Goering.sit2012-10-01 17:27 3.5M 
[   ]David Irving - HW1.pdf2012-10-01 17:29 3.6M 
[   ]David Irving - Hess.zip2012-10-01 17:31 1.8M 
[   ]David Irving - Keitel.zip2012-10-01 17:31 1.0M 
[   ]David Irving - MaresNest.zip2012-10-01 17:34 1.0M 
[   ]David Irving - Milch.zip2012-10-01 17:32 2.1M 
[   ]David Irving - Morell.zip2012-10-01 17:33 881K 
[   ]David Irving - Morgenthau_Plan.zip2012-10-01 17:32 215K 
[   ]David Irving - NUREMBERG.pdf2012-10-01 17:33 1.5M 
[   ]David Irving - Pt1.zip2012-10-01 17:30 1.6M 
[   ]David Irving - Pt2.zip2012-10-01 17:31 1.7M 
[   ]David Irving - Pt3.zip2012-10-01 17:31 2.1M 
[   ]David Irving - Pt4.zip2012-10-01 17:28 454K 
[   ]David Irving - ReichHoertMit.zip2012-10-01 17:31 1.0M 
[   ]David Irving - Rommel_illustr.zip2012-10-01 17:33 4.5M 
[   ]David Irving - The Destruction of Convoy PQ. 17 - 1968edition2012-10-01 17:30 2.2M 
[   ]David Irving - Uprising.zip2012-10-01 17:31 2.0M 
[TXT]David Irving the 'Anti-Semite'.htm2012-10-01 17:29 5.2K 
[DIR]David Irving the 'Anti-Semite'_files/2015-10-04 18:43 -  
[   ]David Lane - 88 Precepts.pdf2012-10-01 17:31 21K 
[TXT]David Lane - Dissension in the Ranks.htm2012-10-01 17:27 11K 
[DIR]David Lane - Dissension in the Ranks_files/2015-10-04 18:43 -  
[   ]David Lane - KD Rebel - 2004.pdf2012-10-01 17:30 425K 
[TXT]David Lane - Letter to the Reality Deniers - by David Lane of The Order - P.O.W.txt2012-10-01 17:28 14K 
[TXT]David_Lane - The Final Address of David Lane to the Jury.htm2012-10-01 17:28 5.3K 
[DIR]David_Lane - The Final Address of David Lane to the Jury_files/2015-10-04 18:43 -  
[   ]DealingInHate.pdf2012-10-01 17:30 192K 
[TXT]Dealing With the Peak Oil Critics.htm2012-10-01 17:32 26K 
[DIR]Dealing With the Peak Oil Critics_files/2015-10-04 18:43 -  
[DIR]Death Gate Cycle/2015-10-04 18:43 -  
[TXT]Debating the Lobby.htm2012-10-01 17:33 3.1K 
[DIR]Debating the Lobby_files/2015-10-04 18:43 -  
[   ]DebunkingGenocideMyth.pdf2012-10-01 17:30 772K 
[   ]Dec01.pdf2012-10-01 17:27 1.0M 
[   ]Dec02.pdf2012-10-01 17:28 1.3M 
[   ]Dec03.pdf2012-10-01 17:31 869K 
[   ]Dec04.pdf2012-10-01 17:28 906K 
[   ]DeclineOfWest.pdf2012-10-01 17:33 422K 
[TXT]Deejay’s Appeal - ‘Kill the Whiteness Inside’.htm2012-10-01 17:31 2.1K 
[DIR]Deejay’s Appeal - ‘Kill the Whiteness Inside’_files/2015-10-04 18:43 -  
[TXT]Deejay - 'I'm Coming for Your Seed'.htm2012-10-01 17:31 28K 
[DIR]Deejay - 'I'm Coming for Your Seed'_files/2015-10-04 18:43 -  
[TXT]Defense Firms Making a Killing on Iraq War.htm2012-10-01 17:30 3.0K 
[DIR]Defense Firms Making a Killing on Iraq War_files/2015-10-04 18:43 -  
[TXT]Defensible Racism.htm2012-10-01 17:33 12K 
[DIR]Defensible Racism_files/2015-10-04 18:43 -  
[TXT]Deir Yassin 1947,.html2012-10-01 17:29 1.3K 
[   ]DemocracyInAmerica.pdf2012-10-01 17:28 6.7M 
[TXT]Democrats Condemn Chertoff's Incompetence.htm2012-10-01 17:31 4.0K 
[DIR]Democrats Condemn Chertoff's Incompetence_files/2015-10-04 18:43 -  
[TXT]Denver National Vanguard - Supporting the Columbus Day Parade.htm2012-10-01 17:28 4.7K 
[DIR]Denver National Vanguard - Supporting the Columbus Day Parade_files/2015-10-04 18:43 -  
[TXT]Desperate Jewish News Outlets Abandoning Last Pretenses of Honesty.htm2012-10-01 17:31 2.8K 
[DIR]Desperate Jewish News Outlets Abandoning Last Pretenses of Honesty_files/2015-10-04 18:43 -  
[   ]DetNewsReprint.pdf2012-10-01 17:32 1.1M 
[TXT]Detainee Paralyzed During Torture in Israeli Prison.htm2012-10-01 17:31 5.1K 
[TXT]Devil's Advocate - The Chinese Have Guts.htm2012-10-01 17:33 7.4K 
[DIR]Devil's Advocate - The Chinese Have Guts_files/2015-10-04 18:43 -  
[TXT]Did Arabs Accidentally Get Canned Pork By Mistake.htm2012-10-01 17:28 3.3K 
[DIR]Did Arabs Accidentally Get Canned Pork By Mistake_files/2015-10-04 18:43 -  
[TXT]Did Time Magazine Lie to Pad Circulation.htm2012-10-01 17:31 3.1K 
[DIR]Did Time Magazine Lie to Pad Circulation_files/2015-10-04 18:43 -  
[TXT]Disaster Buck Stopped at Chertoff, Not Brown.htm2012-10-01 17:31 3.5K 
[DIR]Disaster Buck Stopped at Chertoff, Not Brown_files/2015-10-04 18:43 -  
[TXT]Discussing Race in a Globalized World.htm2012-10-01 17:33 11K 
[DIR]Discussing Race in a Globalized World_files/2015-10-04 18:43 -  
[   ]DiversityAtWork.pdf2012-10-01 17:28 76K 
[TXT]Diversity Can Only Be Countered With Brutality And War.htm2012-10-01 17:29 46K 
[DIR]Diversity Can Only Be Countered With Brutality And War_files/2015-10-04 18:43 -  
[TXT]Dividing the World.htm2012-10-01 17:31 22K 
[DIR]Dividing the World_files/2015-10-04 18:43 -  
[TXT]Do Blacks Deserve Billions for Slavery.htm2012-10-01 17:33 12K 
[DIR]Do Blacks Deserve Billions for Slavery_files/2015-10-04 18:43 -  
[TXT]Do They Think It’s Worth It.htm2012-10-01 17:33 13K 
[DIR]Do They Think It’s Worth It_files/2015-10-04 18:43 -  
[TXT]Do Whites Really Deserve to Exist.htm2012-10-01 17:32 9.7K 
[DIR]Do Whites Really Deserve to Exist_files/2015-10-04 18:43 -  
[   ]Doty_H2Price.pdf2012-10-01 17:27 330K 
[   ]Dr. David Duke - My Awakening - Complete Book from SolarGeneral_com.pdf2012-10-01 17:29 25M 
[DIR]Dr. Lorraine Day’s Response to Judy Andreas - zionism -_files/2015-10-04 18:43 -  
[TXT]Dr. Lorraine Day’s Response to Judy Andreas - zionism.htm2012-10-01 17:33 60K 
[   ]Dr. William Pierce - The Turner Diaries.pdf2012-10-01 17:29 810K 
[TXT]Dreaming of a Black Christmas.htm2012-10-01 17:33 5.1K 
[DIR]Dreaming of a Black Christmas_files/2015-10-04 18:43 -  
[TXT]Dream of inter-racial cooperation finally a UK reality.htm2012-10-01 17:31 2.6K 
[DIR]Dream of inter-racial cooperation finally a UK reality_files/2015-10-04 18:43 -  
[TXT]Drug Feud Claims Life of Anti-White Activist.htm2012-10-01 17:33 5.2K 
[DIR]Drug Feud Claims Life of Anti-White Activist_files/2015-10-04 18:43 -  
[TXT]Dumbing Down America.htm2012-10-01 17:30 4.1K 
[DIR]Dumbing Down America_files/2015-10-04 18:43 -  
[   ]DuneSeries.zip2012-10-01 17:31 7.1M 
[TXT]Dutch Inquisition Reborn.htm2012-10-01 17:34 6.7K 
[DIR]Dutch Inquisition Reborn_files/2015-10-04 18:43 -  
[TXT]Dutch to Become First European Nation to Ban Burka.htm2012-10-01 17:33 2.2K 
[DIR]Dutch to Become First European Nation to Ban Burka_files/2015-10-04 18:43 -  
[   ]Dynohub_assembly.pdf2012-10-01 17:28 264K 
[   ]EBlowback_911.pdf2012-10-01 17:31 7.7M 
[   ]EFBI_CIA_mob_treachery.pdf2012-10-01 17:28 2.7M 
[   ]EIraq_lies.pdf2012-10-01 17:32 4.1M 
[   ]EURO-DNA1.0 & ANCESTRYBYDNA2.5 - USER MANUAL.pdf2012-10-01 17:30 249K 
[TXT]Ebonics Suggested for District.htm2012-10-01 17:30 2.4K 
[DIR]Ebonics Suggested for District_files/2015-10-04 18:43 -  
[   ]EcritsRevisionnistes.pdf2012-10-01 17:33 271K 
[   ]EdictOfExpulsion.pdf2012-10-01 17:31 41K 
[TXT]Editing Martin Luther King, Jr.htm2012-10-01 17:31 37K 
[DIR]Editing Martin Luther King, Jr_files/2015-10-04 18:43 -  
[TXT]Educational Sabotage.htm2012-10-01 17:31 35K 
[DIR]Educational Sabotage_files/2015-10-04 18:43 -  
[TXT]Educators Baffled at Stubborn Achievement Gap.htm2012-10-01 17:32 13K 
[DIR]Educators Baffled at Stubborn Achievement Gap_files/2015-10-04 18:43 -  
[TXT]Edward Fagan Sues Lloyd's of London, U.S. Government.htm2012-10-01 17:31 3.4K 
[DIR]Edward Fagan Sues Lloyd's of London, U.S. Government_files/2015-10-04 18:43 -  
[   ]Edwards.pdf2012-10-01 17:31 64K 
[   ]EinsteinConspiracy.pdf2012-10-01 17:31 463K 
[   ]EinsteinHoax.pdf2012-10-01 17:28 3.8M 
[TXT]EinsteinStoleE=mc2.htm2012-10-01 17:31 10K 
[DIR]EinsteinStoleE=mc2_files/2015-10-04 18:43 -  
[TXT]Eire - YOU DID IT! Now Let's Build On the Success.htm2012-10-01 17:31 4.3K 
[DIR]Eire - YOU DID IT! Now Let's Build On the Success_files/2015-10-04 18:43 -  
[   ]EisenhowersHolocaust.pdf2012-10-01 17:27 20K 
[   ]Elias Lönnrot - The Kalevala - 1888.pdf2012-10-01 17:28 1.0M 
[TXT]Elizabeth Smith - A Woman Looks at the Lifetime Channel.htm2012-10-01 17:32 10K 
[DIR]Elizabeth Smith - A Woman Looks at the Lifetime Channel_files/2015-10-04 18:43 -  
[TXT]Ellin Anderson - 2005-12-22 - In This Sign.txt2012-10-01 17:31 14K 
[TXT]Empowerment by Rape - the Sexual Holocaust.htm2012-10-01 17:31 13K 
[DIR]Empowerment by Rape - the Sexual Holocaust_files/2015-10-04 18:43 -  
[   ]EndKingHolodayNew.pdf2012-10-01 17:31 109K 
[   ]EndTheKingHoloday.pdf2012-10-01 17:31 223K 
[TXT]Ending the Dollar's Tyranny.htm2012-10-01 17:30 19K 
[DIR]Ending the Dollar's Tyranny_files/2015-10-04 18:43 -  
[TXT]End of an Era - Spearhead to Close.htm2012-10-01 17:31 2.6K 
[DIR]End of an Era - Spearhead to Close_files/2015-10-04 18:43 -  
[TXT]End of the Rainbow.htm2012-10-01 17:32 4.9K 
[DIR]End of the Rainbow_files/2015-10-04 18:43 -  
[   ]EnemyOfEurope.pdf2012-10-01 17:33 546K 
[TXT]England Prepares to Honor Millenium of First Patron Saint.htm2012-10-01 17:31 4.4K 
[DIR]England Prepares to Honor Millenium of First Patron Saint_files/2015-10-04 18:43 -  
[TXT]English Lad 'Too Pale'.htm2012-10-01 17:33 2.7K 
[DIR]English Lad 'Too Pale'_files/2015-10-04 18:43 -  
[TXT]Englishman's Zimbabwean Road Trip to Texas.htm2012-10-01 17:33 2.7K 
[DIR]Englishman's Zimbabwean Road Trip to Texas_files/2015-10-04 18:43 -  
[TXT]Enron - A Microcosm of America.htm2012-10-01 17:32 5.8K 
[DIR]Enron - A Microcosm of America_files/2015-10-04 18:43 -  
[   ]Erik the Norseman A Nation Betrayed.doc2012-10-01 17:32 34K 
[   ]Erik the Norseman An Essay on Comparative Horror.doc2012-10-01 17:27 28K 
[   ]Erik the Norseman Boy Meets Boy - Boy Takes Boy to the Prom.doc2012-10-01 17:33 25K 
[   ]Erik the Norseman Canada Diagnosis - CRITICAL.doc2012-10-01 17:28 25K 
[   ]Erik the Norseman Canadian Homelessness - A White Problem.doc2012-10-01 17:28 30K 
[   ]Erik the Norseman Canadians Can Say What They Want, Eh!.doc2012-10-01 17:33 24K 
[   ]Erik the Norseman GOOD MORNING CANADA! Wake Up and Smell the.doc2012-10-01 17:34 27K 
[   ]Erik the Norseman Iraq Proof Islam is a Nest of Vipers.doc2012-10-01 17:31 30K 
[   ]Erik the Norseman Just Who Is an Aboriginal.doc2012-10-01 17:31 30K 
[   ]Erik the Norseman Loss of Sovereignty to Globalism.doc2012-10-01 17:27 29K 
[   ]Erik the Norseman Misplaced Hate.doc2012-10-01 17:31 26K 
[   ]Erik the Norseman Paul Fromm Speaks in Vancouver Another suc.doc2012-10-01 17:30 28K 
[   ]Erik the Norseman Promotion Anyone.doc2012-10-01 17:31 27K 
[   ]Erik the Norseman SARS Politically Correct Disease.doc2012-10-01 17:32 40K 
[   ]Erik the Norseman Same Rights = Special Rights.doc2012-10-01 17:28 28K 
[   ]Erik the Norseman Some Dominion Day Reflections on the Benef.doc2012-10-01 17:31 29K 
[   ]Erik the Norseman Some Thoughts of a Proud Racialist.doc2012-10-01 17:30 33K 
[   ]Erik the Norseman Some Thoughts on Abortion.doc2012-10-01 17:28 30K 
[   ]Erik the Norseman Some Thoughts on Native Land Claims.doc2012-10-01 17:28 33K 
[   ]Erik the Norseman Some Thoughts on Privatization.doc2012-10-01 17:33 29K 
[   ]Erik the Norseman Some Thoughts on the Future of Transportat.doc2012-10-01 17:30 25K 
[   ]Erik the Norseman Some Thoughts on the Judiciary.doc2012-10-01 17:31 36K 
[   ]Erik the Norseman Some Thoughts on the Prison System.doc2012-10-01 17:34 29K 
[   ]Erik the Norseman The Paradox of Complimentary Medicine.doc2012-10-01 17:28 26K 
[   ]Erik the Norseman The People's Lament.doc2012-10-01 17:30 59K 
[   ]Erik the Norseman The Zahra Kazemi Debaucle Back in the News.doc2012-10-01 17:31 29K 
[   ]Erik the Norseman What Is an Aboriginal.doc2012-10-01 17:28 29K 
[   ]Erik the Norseman When is a Jew a Jew A call to White Evange.doc2012-10-01 17:33 26K 
[   ]Erik the Norseman White Pride or White Guilt.doc2012-10-01 17:27 40K 
[   ]Erik the Norseman Who Built Canada.doc2012-10-01 17:30 25K 
[   ]Erik the Norseman Who are the Welfare Bums.doc2012-10-01 17:30 27K 
[TXT]Ethiopian Government Begs After Bumper Crop.htm2012-10-01 17:31 2.2K 
[DIR]Ethiopian Government Begs After Bumper Crop_files/2015-10-04 18:43 -  
[   ]EugenicsManifesto.pdf2012-10-01 17:27 346K 
[TXT]Euro 2005 DVD.htm2012-10-01 17:32 2.5K 
[DIR]Euro 2005 DVD_files/2015-10-04 18:43 -  
[TXT]Euro Slurs and Hate Caricatures.htm2012-10-01 17:33 22K 
[DIR]Euro Slurs and Hate Caricatures_files/2015-10-04 18:43 -  
[TXT]Europe’s Successful Moon Probe Mission.htm2012-10-01 17:28 5.7K 
[DIR]Europe’s Successful Moon Probe Mission_files/2015-10-04 18:43 -  
[TXT]European Origins of Halloween.htm2012-10-01 17:28 6.2K 
[DIR]European Origins of Halloween_files/2015-10-04 18:43 -  
[TXT]European Union Applies 'Hate Speech' Rules to Internet.htm2012-10-01 17:30 2.1K 
[DIR]European Union Applies 'Hate Speech' Rules to Internet_files/2015-10-04 18:43 -  
[TXT]Europeans Having Second Thoughts about Turkey.htm2012-10-01 17:31 6.0K 
[DIR]Europeans Having Second Thoughts about Turkey_files/2015-10-04 18:43 -  
[   ]Evan Thomas 2005-11-04 - UN to Celebrate Jan. 27 as 'Holocaust Day'2012-10-01 17:29 5.1K 
[TXT]Ex-IRA Soldier Condemns Loss of Traditional Ireland.htm2012-10-01 17:28 3.0K 
[DIR]Ex-IRA Soldier Condemns Loss of Traditional Ireland_files/2015-10-04 18:43 -  
[TXT]Ex-Security Chief Blows Whistle on UN's Kosovo Mission.htm2012-10-01 17:30 4.6K 
[DIR]Ex-Security Chief Blows Whistle on UN's Kosovo Mission_files/2015-10-04 18:43 -  
[TXT]Exercise, It’s Not What Your Doctor Prescribed.htm2012-10-01 17:33 3.7K 
[DIR]Exercise, It’s Not What Your Doctor Prescribed_files/2015-10-04 18:43 -  
[TXT]Exodus Remembered_ Passover Inspires Parasite Jewish Concern for Immigrants (But None for Well-Being of Host Nation Citizens).html2012-10-01 17:28 41K 
[TXT]F95-2.htm2012-10-01 17:33 8.4K 
[   ]FEST_FLIER.pdf2012-10-01 17:27 8.5K 
[   ]FFNewsF05.pdf2012-10-01 17:30 668K 
[   ]FLIER-1.pdf2012-10-01 17:27 111K 
[   ]FLIER-2.pdf2012-10-01 17:32 46K 
[   ]FLIER-3.pdf2012-10-01 17:31 51K 
[   ]FLIER-4.pdf2012-10-01 17:27 80K 
[   ]FLIER-5.pdf2012-10-01 17:30 85K 
[   ]FLYER-6.pdf2012-10-01 17:27 88K 
[   ]FOMCalendar.pdf2012-10-01 17:31 92K 
[   ]FRIPamphlets.pdf2012-10-01 17:28 727K 
[   ]FS02-10.pdf2012-10-01 17:30 1.1M 
[   ]Facts.pdf2012-10-01 17:33 2.7M 
[TXT]Facts To Consider Concerning The Holocaust.htm2012-10-01 17:30 120K 
[DIR]Facts To Consider Concerning The Holocaust_files/2015-10-04 18:43 -  
[TXT]Fading Illusions - D-Day and Reagan.htm2012-10-01 17:27 26K 
[DIR]Fading Illusions - D-Day and Reagan_files/2015-10-04 18:43 -  
[   ]FagFacts.pdf2012-10-01 17:31 194K 
[   ]FagFlyer.pdf2012-10-01 17:31 50K 
[TXT]Fagan Files $1 Billion 'Holocaust Compensation' Lawsuit.htm2012-10-01 17:28 3.1K 
[DIR]Fagan Files $1 Billion 'Holocaust Compensation' Lawsuit_files/2015-10-04 18:43 -  
[TXT]Failures of Our Age - Capitalism and Communism.htm2012-10-01 17:33 24K 
[DIR]Failures of Our Age - Capitalism and Communism_files/2015-10-04 18:43 -  
[TXT]Famous people with Scotch Irish blood.htm2012-10-01 17:32 105K 
[DIR]Famous people with Scotch Irish blood_files/2015-10-04 18:43 -  
[TXT]Farewell to a Good European.htm2012-10-01 17:31 6.3K 
[DIR]Farewell to a Good European_files/2015-10-04 18:43 -  
[TXT]Fast Times at Regnef High - crying-wolf.htm2012-10-01 17:33 37K 
[DIR]Fast Times at Regnef High - crying-wolf_files/2015-10-04 18:43 -  
[   ]FearAndTrembling.pdf2012-10-01 17:32 325K 
[TXT]Fear and Illusion.htm2012-10-01 17:31 3.5K 
[DIR]Fear and Illusion_files/2015-10-04 18:43 -  
[   ]Feb01.pdf2012-10-01 17:28 392K 
[   ]Feb02.pdf2012-10-01 17:29 1.7M 
[   ]Feb04.pdf2012-10-01 17:34 1.9M 
[TXT]Feds Say Katrina Refugee Gangs a Threat.htm2012-10-01 17:33 3.4K 
[DIR]Feds Say Katrina Refugee Gangs a Threat_files/2015-10-04 18:43 -  
[   ]FestumAlbum.doc2012-10-01 17:27 540K 
[TXT]Fewer Than 50,000 Whites in Zimbabwe.htm2012-10-01 17:33 3.4K 
[DIR]Fewer Than 50,000 Whites in Zimbabwe_files/2015-10-04 18:43 -  
[TXT]Fighting Organized Crime.htm2012-10-01 17:28 26K 
[DIR]Fighting Organized Crime_files/2015-10-04 18:43 -  
[TXT]Final Verdict - The false connection between Tim McVeigh and The Turner Diaries.htm2012-10-01 17:31 28K 
[DIR]Final Verdict - The false connection between Tim McVeigh and The Turner Diaries_files/2015-10-04 18:43 -  
[TXT]Finkelstein Debates Israeli Pol.htm2012-10-01 17:31 15K 
[DIR]Finkelstein Debates Israeli Pol_files/2015-10-04 18:43 -  
[   ]FirstTheyCameForTheArabs.pdf2012-10-01 17:30 19K 
[TXT]Five Myths That Sanction Israel's War Crimes.htm2012-10-01 17:33 50K 
[DIR]Five Myths That Sanction Israel's War Crimes_files/2015-10-04 18:43 -  
[   ]FlorentineChronicle.pdf2012-10-01 17:32 41K 
[TXT]Florida - 'King Tut' Prompts Black Protests.htm2012-10-01 17:34 3.9K 
[DIR]Florida - 'King Tut' Prompts Black Protests_files/2015-10-04 18:43 -  
[TXT]Florida - Homeowners Association Says 'No' to Evacuees.htm2012-10-01 17:31 3.7K 
[DIR]Florida - Homeowners Association Says 'No' to Evacuees_files/2015-10-04 18:43 -  
[TXT]Florida - Vote Ubele.htm2012-10-01 17:31 2.9K 
[DIR]Florida - Vote Ubele_files/2015-10-04 18:43 -  
[TXT]Florida School Board Rejects Hall's Resignation.htm2012-10-01 17:33 3.5K 
[DIR]Florida School Board Rejects Hall's Resignation_files/2015-10-04 18:43 -  
[   ]Flyer.pdf2012-10-01 17:33 487K 
[   ]ForeignersAroundTheWorld.pdf2012-10-01 17:34 741K 
[TXT]Foreword to the new edition - Zundel's Story.htm2012-10-01 17:32 31K 
[DIR]Foreword to the new edition - Zundel's Story_files/2015-10-04 18:43 -  
[DIR]Forgotten Realms/2015-10-04 18:43 -  
[TXT]Former Reps. Earl Hilliard (D-Ala.) and Cynthia McKinney (D-Ga.) - Bad for Israel.htm2012-10-01 17:29 4.0K 
[DIR]Former Reps. Earl Hilliard (D-Ala.) and Cynthia McKinney (D-Ga.) - Bad for Israel_files/2015-10-04 18:43 -  
[TXT]France - Another 'Hate Crime' Hoax.htm2012-10-01 17:30 2.7K 
[TXT]France - Chirac Calls for Police State to Enforce Multiracialism.htm2012-10-01 17:28 5.4K 
[DIR]France - Chirac Calls for Police State to Enforce Multiracialism_files/2015-10-04 18:43 -  
[TXT]France - Teacher in Hiding.htm2012-10-01 17:33 3.4K 
[DIR]France - Teacher in Hiding_files/2015-10-04 18:43 -  
[TXT]France - Turks Must Admit Genocide.htm2012-10-01 17:27 3.0K 
[DIR]France - Turks Must Admit Genocide_files/2015-10-04 18:43 -  
[TXT]France Lays Dauphin to Rest.htm2012-10-01 17:30 5.2K 
[DIR]France Lays Dauphin to Rest_files/2015-10-04 18:43 -  
[TXT]Frank Ellis article (unedited) - 2006-03-27 - Chris Brand comment.txt2012-10-01 17:33 24K 
[IMG]FrankLynchedLarge.jpeg2012-10-01 17:33 78K 
[TXT]Frank Roman - 2006-10-07 - Impeach The System.htm2012-10-01 17:30 6.4K 
[DIR]Frank Roman - 2006-10-07 - Impeach The System_files/2015-10-04 18:43 -  
[TXT]Frankfurt School Aikido.htm2012-10-01 17:32 27K 
[TXT]Free Pro-European Music.htm2012-10-01 17:28 2.8K 
[DIR]Free Pro-European Music_files/2015-10-04 18:43 -  
[TXT]Free Speech Can Be Fatal.htm2012-10-01 17:31 4.9K 
[DIR]Free Speech Can Be Fatal_files/2015-10-04 18:43 -  
[TXT]Free Speech Hypocrisy.htm2012-10-01 17:32 1.9K 
[TXT]French culture in vice grip of Muslims both internally and externally.htm2012-10-01 17:30 3.9K 
[TXT]Friends of Ulster - USA Scotch Irish _ Ulster Scots.htm2012-10-01 17:31 419K 
[DIR]Friends of Ulster - USA Scotch Irish _ Ulster Scots_files/2015-10-04 18:43 -  
[TXT]Front National MP Suspended from Teaching Position for Calling for Open Debate.htm2012-10-01 17:34 2.8K 
[DIR]Front National MP Suspended from Teaching Position for Calling for Open Debate_files/2015-10-04 18:43 -  
[TXT]Full Text of Ahmadinejad's Letter to Merkel.htm2012-10-01 17:28 19K 
[DIR]Full Text of Ahmadinejad's Letter to Merkel_files/2015-10-04 18:43 -  
[   ]GFactor.pdf2012-10-01 17:32 722K 
[   ]GasChamberExecution.pdf2012-10-01 17:33 40K 
[TXT]Genes Trace the Ancient Wanderings of White People.htm2012-10-01 17:31 7.8K 
[DIR]Genes Trace the Ancient Wanderings of White People_files/2015-10-04 18:43 -  
[TXT]Genetic Branching - Keep it Going.htm2012-10-01 17:29 13K 
[DIR]Genetic Branching - Keep it Going_files/2015-10-04 18:43 -  
[   ]George Orwell - 1984.pdf2012-10-01 17:31 564K 
[   ]GermanLawAndLegislation.pdf2012-10-01 17:34 65K 
[   ]GermanLawAndLegislation.rtf2012-10-01 17:27 88K 
[TXT]German Politicians Talk Turkey.htm2012-10-01 17:32 2.6K 
[DIR]German Politicians Talk Turkey_files/2015-10-04 18:43 -  
[TXT]Germany - PC Gift to Patriots.htm2012-10-01 17:33 2.9K 
[DIR]Germany - PC Gift to Patriots_files/2015-10-04 18:43 -  
[   ]Giant.pdf2012-10-01 17:31 1.4M 
[TXT]Give Them Lead, Not Silver.htm2012-10-01 17:33 3.0K 
[TXT]God, Religion, and Tribal Conflict.htm2012-10-01 17:28 30K 
[DIR]God, Religion, and Tribal Conflict_files/2015-10-04 18:43 -  
[   ]Goebbels.pdf2012-10-01 17:31 2.9M 
[   ]Goering.pdf2012-10-01 17:31 3.8M 
[TXT]Governor Schwarzenegger's Statement Denying Tookie Clemency.htm2012-10-01 17:30 12K 
[DIR]Governor Schwarzenegger's Statement Denying Tookie Clemency_files/2015-10-04 18:43 -  
[   ]Gramage's DVD copying guide - v2 .rtf2012-10-01 17:34 16K 
[TXT]Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust.htm2012-10-01 17:32 13K 
[TXT]Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust.txt2012-10-01 17:34 12K 
[DIR]Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust_files/2015-10-04 18:43 -  
[TXT]Guazzo.html2012-10-01 17:28 10K 
[TXT]Guilt March Hosts Named For Plagiarist.htm2012-10-01 17:27 5.8K 
[DIR]Guilt March Hosts Named For Plagiarist_files/2015-10-04 18:43 -  
[TXT]Guts - A White Man Who Won't Back Down.htm2012-10-01 17:32 4.3K 
[DIR]Guts - A White Man Who Won't Back Down_files/2015-10-04 18:43 -  
[TXT]Guy Ritchie - Kabbalah Ruined My Film.htm2012-10-01 17:30 4.1K 
[DIR]Guy Ritchie - Kabbalah Ruined My Film_files/2015-10-04 18:43 -  
[   ]H067172052X.zip2012-10-01 17:28 398K 
[TXT]HILLARY, TORRICELLI DONOR'S FUNNY MONEY Port's New Head, Sued by Brother, Faces an Inquiry.htm2012-10-01 17:31 62K 
[TXT]H Millard - Homeless Jack on Iran, Freedom, Intellectuals, and the Holocaust.htm2012-10-01 17:31 13K 
[DIR]H Millard - Homeless Jack on Iran, Freedom, Intellectuals, and the Holocaust_files/2015-10-04 18:43 -  
[   ]HW1.pdf2012-10-01 17:31 3.6M 
[   ]HWT-Brizahpage.PDF2012-10-01 17:30 452K 
[   ]HW_Web.pdf2012-10-01 17:28 3.9M 
[   ]HW_Web_dl.pdf2012-10-01 17:27 4.6M 
[TXT]Half of Katrina Refugees Are Criminals.htm2012-10-01 17:29 3.6K 
[DIR]Half of Katrina Refugees Are Criminals_files/2015-10-04 18:43 -  
[TXT]Hans Christian Andersen (1845) - Holger Danske.htm2012-10-01 17:29 11K 
[DIR]Hans Christian Andersen (1845) - Holger Danske_files/2015-10-04 18:43 -  
[TXT]Happy German-American Day.htm2012-10-01 17:29 3.4K 
[DIR]Happy German-American Day_files/2015-10-04 18:43 -  
[   ]Harold A. Covington - A Distant Thunder.doc2012-10-01 17:34 1.3M 
[TXT]Has King Tut Been 'Whitewashed'.htm2012-10-01 17:27 2.5K 
[DIR]Has King Tut Been 'Whitewashed'_files/2015-10-04 18:43 -  
[TXT]Head of Homeland Security Has Ties With Suspected Financier of 911.htm2012-10-01 17:31 2.0K 
[DIR]Head of Homeland Security Has Ties With Suspected Financier of 911_files/2015-10-04 18:43 -  
[TXT]Heather Mac Donald on Immigration on National Review Online - A Latin conservative tidal wave is not coming.htm2012-10-01 17:33 8.0K 
[DIR]Heather Mac Donald on Immigration on National Review Online - A Latin conservative tidal wave is not coming_files/2015-10-04 18:43 -  
[   ]Henry David Thoreau - Civil Disobedience.pdf2012-10-01 17:28 88K 
[TXT]Henry Ford - 1922-01-07 - Candid Address to Jews on the Jewish Problem.htm2012-10-01 17:30 29K 
[DIR]Henry Ford - 1922-01-07 - Candid Address to Jews on the Jewish Problem_files/2015-10-04 18:43 -  
[TXT]Henry Kissinger - The Walking, Talking Conflict of Interest.htm2012-10-01 17:33 22K 
[DIR]Henry Kissinger - The Walking, Talking Conflict of Interest_files/2015-10-04 18:43 -  
[   ]Hess.pdf2012-10-01 17:31 2.1M 
[TXT]Hezbollah Broke Israeli Codes.htm2012-10-01 17:34 3.2K 
[DIR]Hezbollah Broke Israeli Codes_files/2015-10-04 18:43 -  
[   ]HighCostOfVengeance.pdf2012-10-01 17:33 212K 
[DIR]High Druid of Shannara/2015-10-04 18:43 -  
[TXT]High School Failure Rate Highest in Non-White Districts.htm2012-10-01 17:28 3.3K 
[DIR]High School Failure Rate Highest in Non-White Districts_files/2015-10-04 18:43 -  
[TXT]Hilarious PC Language Lesson.htm2012-10-01 17:28 4.0K 
[DIR]Hilarious PC Language Lesson_files/2015-10-04 18:43 -  
[   ]Himmelfarb.pdf2012-10-01 17:32 122K 
[   ]HispanicsReport.pdf2012-10-01 17:29 1.0M 
[TXT]Historical Myth Justifies Golan Heights Occupation.htm2012-10-01 17:28 5.5K 
[DIR]Historical Myth Justifies Golan Heights Occupation_files/2015-10-04 18:43 -  
[DIR]Historical Revisionism – International and Independent Scientific Historical Research/2015-10-04 18:43 -  
[TXT]History of the Original Ku Klux Klan.txt2012-10-01 17:31 47K 
[   ]HitlerLifeOfALeader.pdf2012-10-01 17:31 6.1M 
[   ]HitlerWeLovedAndWhy.rtf2012-10-01 17:31 89K 
[TXT]Hmong Immigrant Commits Mass Murder in Northern Wisconsin.htm2012-10-01 17:31 5.7K 
[DIR]Hmong Immigrant Commits Mass Murder in Northern Wisconsin_files/2015-10-04 18:43 -  
[TXT]Hockney's Secret Knowledge - Refuted.htm2012-10-01 17:33 2.5K 
[DIR]Hockney's Secret Knowledge - Refuted_files/2015-10-04 18:43 -  
[TXT]Holger Dansk - Denmark's Mountain King.htm2012-10-01 17:31 19K 
[DIR]Holger Dansk - Denmark's Mountain King_files/2015-10-04 18:43 -  
[   ]HollyhoaxMadeInRussia.pdf2012-10-01 17:30 18M 
[TXT]Hollywood Slanders Italian Americans.htm2012-10-01 17:28 4.3K 
[DIR]Hollywood Slanders Italian Americans_files/2015-10-04 18:43 -  
[   ]Holo-Jokes.pdf2012-10-01 17:33 54K 
[   ]HolocaustDenial2005.pdf2012-10-01 17:32 259K 
[TXT]Holocaust Fraud.htm2012-10-01 17:31 13K 
[DIR]Holocaust Fraud_files/2015-10-04 18:43 -  
[TXT]Holocaust Hoax to be Hammered at Upcoming Conference in Iran.htm2012-10-01 17:30 6.7K 
[DIR]Holocaust Hoax to be Hammered at Upcoming Conference in Iran_files/2015-10-04 18:43 -  
[TXT]Holocaust Lawyer Faces $3.2 Million Malpractice Judgment.htm2012-10-01 17:33 2.6K 
[DIR]Holocaust Lawyer Faces $3.2 Million Malpractice Judgment_files/2015-10-04 18:43 -  
[   ]HolyBookOfAdolfHitler.pdf2012-10-01 17:30 141K 
[   ]HolyBookOfAdolfHitler.rtf2012-10-01 17:33 187K 
[TXT]Homeland Security's Casualties.htm2012-10-01 17:30 6.8K 
[DIR]Homeland Security's Casualties_files/2015-10-04 18:43 -  
[TXT]Homeland Security Nominee Chertoff Aided 9-11 Terror Suspect.htm2012-10-01 17:34 17K 
[DIR]Homeland Security Nominee Chertoff Aided 9-11 Terror Suspect_files/2015-10-04 18:43 -  
[TXT]Homeless Jack Offers a Primer.htm2012-10-01 17:28 13K 
[DIR]Homeless Jack Offers a Primer_files/2015-10-04 18:43 -  
[TXT]Homeless Jack on New Orleans.htm2012-10-01 17:32 8.3K 
[DIR]Homeless Jack on New Orleans_files/2015-10-04 18:43 -  
[TXT]Home on the Range.htm2012-10-01 17:31 6.9K 
[DIR]Home on the Range_files/2015-10-04 18:43 -  
[TXT]Homosexual Groups Trying to Distance Themselves From Foley.htm2012-10-01 17:31 3.9K 
[DIR]Homosexual Groups Trying to Distance Themselves From Foley_files/2015-10-04 18:43 -  
[   ]Honest Money.pdf2012-10-01 17:33 225K 
[TXT]Honoring Robert E. Lee.htm2012-10-01 17:31 11K 
[DIR]Honoring Robert E. Lee_files/2015-10-04 18:43 -  
[TXT]Houston - Turf War Breaks Out between Katrina Refugees, Locals.htm2012-10-01 17:33 3.2K 
[DIR]Houston - Turf War Breaks Out between Katrina Refugees, Locals_files/2015-10-04 18:43 -  
[TXT]How Many More Nations Will Israel Attack.htm2012-10-01 17:34 10K 
[DIR]How Many More Nations Will Israel Attack_files/2015-10-04 18:43 -  
[TXT]How Many Tanks Did Israel Lose.htm2012-10-01 17:28 5.0K 
[DIR]How Many Tanks Did Israel Lose_files/2015-10-04 18:43 -  
[TXT]How Muslims Deal With Third World Immigrants.htm2012-10-01 17:27 2.9K 
[DIR]How Muslims Deal With Third World Immigrants_files/2015-10-04 18:43 -  
[TXT]How New Orleans Was Lost.htm2012-10-01 17:33 3.0K 
[DIR]How New Orleans Was Lost_files/2015-10-04 18:43 -  
[TXT]How Small Genetic Differences Give Racial Divergency.htm2012-10-01 17:28 21K 
[DIR]How Small Genetic Differences Give Racial Divergency_files/2015-10-04 18:43 -  
[   ]How To Burn Bootable Disks & Install OS X from External Volumes.rtf2012-10-01 17:30 14K 
[TXT]How Unskilled Immigrants Hurt Our Economy.htm2012-10-01 17:33 3.7K 
[DIR]How Unskilled Immigrants Hurt Our Economy_files/2015-10-04 18:43 -  
[TXT]How a Non-White Country Treats Asylum Invaders.htm2012-10-01 17:30 6.1K 
[   ]How to Crack CD Protections.pdf2012-10-01 17:31 30K 
[   ]How to Develop Super Power Memory.pdf2012-10-01 17:31 2.5M 
[   ]How to rebuild a Li-Ion pack.pdf2012-10-01 17:33 1.6M 
[   ]Hueng Metal Hydrides BCC 033003.pdf2012-10-01 17:28 899K 
[TXT]Hugo Chavez - Rise Up Against the Empire.htm2012-10-01 17:27 18K 
[DIR]Hugo Chavez - Rise Up Against the Empire_files/2015-10-04 18:43 -  
[   ]Hunter.pdf2012-10-01 17:33 1.1M 
[TXT]Hurricane Katrina - Blacks Worsen Disaster.htm2012-10-01 17:33 5.7K 
[DIR]Hurricane Katrina - Blacks Worsen Disaster_files/2015-10-04 18:43 -  
[TXT]Hurricane Katrina Devastates Duke Headquarters.htm2012-10-01 17:33 6.1K 
[DIR]Hurricane Katrina Devastates Duke Headquarters_files/2015-10-04 18:43 -  
[TXT]Hurricane Katrina and Black Behavior.htm2012-10-01 17:29 4.7K 
[DIR]Hurricane Katrina and Black Behavior_files/2015-10-04 18:43 -  
[   ]Hurricane Tracking Chart - Atlantic Basin.pdf2012-10-01 17:28 108K 
[   ]Hurricane Tracking Chart - Atlantic Basin West.pdf2012-10-01 17:31 906K 
[   ]Hurricane Tracking Chart - East Pacific.pdf2012-10-01 17:33 289K 
[TXT]Hushed-up Israeli Spy Operations against USA and Mexico 2000 - 2003.htm2012-10-01 17:28 34K 
[DIR]Hushed-up Israeli Spy Operations against USA and Mexico 2000 - 2003_files/2015-10-04 18:43 -  
[   ]IHRLeaflets.pdf2012-10-01 17:28 285K 
[   ]IHRupdate_November_2005.pdf2012-10-01 17:30 1.5M 
[TXT]I Was Israel’s Dupe.htm2012-10-01 17:28 5.7K 
[DIR]I Was Israel’s Dupe_files/2015-10-04 18:43 -  
[   ]I Wonder What The Tiger Thinks.rtf2012-10-01 17:31 3.2K 
[TXT]If You Tolerate This....htm2012-10-01 17:28 17K 
[DIR]If You Tolerate This..._files/2015-10-04 18:43 -  
[   ]IfanAgentKnocks.pdf2012-10-01 17:34 17K 
[TXT]Igniting the Spark - An Interview With David Duke.htm2012-10-01 17:29 30K 
[DIR]Igniting the Spark - An Interview With David Duke_files/2015-10-04 18:43 -  
[TXT]Illegal Immigration - War with Mexico Approaches.htm2012-10-01 17:28 3.2K 
[DIR]Illegal Immigration - War with Mexico Approaches_files/2015-10-04 18:43 -  
[   ]IllegalImmigrationMyths.pdf2012-10-01 17:34 75K 
[TXT]Illegal Immigration Sparks Race War in Cities, Prisions.htm2012-10-01 17:30 7.8K 
[DIR]Illegal Immigration Sparks Race War in Cities, Prisions_files/2015-10-04 18:43 -  
[TXT]Illegal Immigration and the Racism of 'Antiracism'.htm2012-10-01 17:31 16K 
[DIR]Illegal Immigration and the Racism of 'Antiracism'_files/2015-10-04 18:43 -  
[TXT]Illegals Demand the 'Right' to Break the Law.htm2012-10-01 17:33 6.7K 
[DIR]Illegals Demand the 'Right' to Break the Law_files/2015-10-04 18:43 -  
[TXT]Illinois Cops - Arabs Beat, Gas Black.htm2012-10-01 17:27 4.0K 
[DIR]Illinois Cops - Arabs Beat, Gas Black_files/2015-10-04 18:43 -  
[   ]Imperium103.pdf2012-10-01 17:30 1.2M 
[   ]InDefenseOfRacism.pdf2012-10-01 17:32 288K 
[TXT]In Italy, Al Qaeda Turns to Organized Crime for Protection.htm2012-10-01 17:31 3.7K 
[DIR]In Italy, Al Qaeda Turns to Organized Crime for Protection_files/2015-10-04 18:43 -  
[TXT]In Praise of Saudi Arabia.htm2012-10-01 17:28 4.8K 
[DIR]In Praise of Saudi Arabia_files/2015-10-04 18:43 -  
[TXT]Indian Schools, Genes, Assimilation, and Illegal Aliens.htm2012-10-01 17:33 16K 
[DIR]Indian Schools, Genes, Assimilation, and Illegal Aliens_files/2015-10-04 18:43 -  
[TXT]Indians Reject Black Claims.htm2012-10-01 17:31 6.3K 
[DIR]Indians Reject Black Claims_files/2015-10-04 18:43 -  
[TXT]Indicted - Republican Corporate Whore DeLay Resigns.htm2012-10-01 17:31 4.1K 
[DIR]Indicted - Republican Corporate Whore DeLay Resigns_files/2015-10-04 18:43 -  
[TXT]Infected Africans Skyrocket AIDS-HIV in Croydon, London.htm2012-10-01 17:31 1.8K 
[   ]IngoSwann-Penetration.pdf2012-10-01 17:33 14M 
[TXT]Institute for Political & International Studies.htm2012-10-01 17:32 17K 
[DIR]Institute for Political & International Studies_files/2015-10-04 18:43 -  
[   ]InternationalJew.pdf2012-10-01 17:29 3.1M 
[   ]InternationalJew.rtf2012-10-01 17:29 2.2M 
[TXT]Interracial Rape Victim - Called by God to 'Minister Against Racism'.htm2012-10-01 17:28 7.2K 
[DIR]Interracial Rape Victim - Called by God to 'Minister Against Racism'_files/2015-10-04 18:43 -  
[TXT]Interview with the Grim Reaper - StantonReaper0905.htm2012-10-01 17:32 17K 
[DIR]Interview with the Grim Reaper - StantonReaper0905_files/2015-10-04 18:43 -  
[TXT]Intro.htm2012-10-01 17:28 17K 
[TXT]Introducing the Global I.D. Card.htm2012-10-01 17:31 2.0K 
[DIR]Introducing the Global I.D. Card_files/2015-10-04 18:43 -  
[   ]Invasion.pdf2012-10-01 17:33 27K 
[TXT]Iran - The 'Holocaust' Threat to World Peace.htm2012-10-01 17:34 22K 
[DIR]Iran - The 'Holocaust' Threat to World Peace_files/2015-10-04 18:43 -  
[TXT]Iranians Produce Holocaust Cartoons.htm2012-10-01 17:32 5.0K 
[DIR]Iranians Produce Holocaust Cartoons_files/2015-10-04 18:43 -  
[TXT]Iraq - Christians Leery of Islamic 'Tolerance'.htm2012-10-01 17:31 3.9K 
[DIR]Iraq - Christians Leery of Islamic 'Tolerance'_files/2015-10-04 18:43 -  
[   ]IraqGassingLies.pdf2012-10-01 17:30 81K 
[TXT]Iraq at the Gates of Hell.htm2012-10-01 17:32 38K 
[DIR]Iraq at the Gates of Hell_files/2015-10-04 18:43 -  
[TXT]Iraqi Resister - Black Soldiers are Targets.htm2012-10-01 17:31 4.6K 
[DIR]Iraqi Resister - Black Soldiers are Targets_files/2015-10-04 18:43 -  
[TXT]Irish Academics Urge Israel Boycott.htm2012-10-01 17:31 3.5K 
[DIR]Irish Academics Urge Israel Boycott_files/2015-10-04 18:43 -  
[   ]IronHeel.pdf2012-10-01 17:28 557K 
[TXT]Irreconcilable Differences.htm2012-10-01 17:32 153K 
[DIR]Irreconcilable Differences_files/2015-10-04 18:43 -  
[TXT]Is Europe Unable to Assimilate Its Growing Islamic Minority.htm2012-10-01 17:30 11K 
[DIR]Is Europe Unable to Assimilate Its Growing Islamic Minority_files/2015-10-04 18:43 -  
[TXT]Is Neocon Spokesman Soliciting Murder of David Duke.htm2012-10-01 17:32 6.9K 
[DIR]Is Neocon Spokesman Soliciting Murder of David Duke_files/2015-10-04 18:43 -  
[TXT]Is There Some Bravery Left in Braveheart.htm2012-10-01 17:31 5.7K 
[DIR]Is There Some Bravery Left in Braveheart_files/2015-10-04 18:43 -  
[TXT]Is any of this stuff made in Israel.htm2012-10-01 17:28 31K 
[DIR]Is any of this stuff made in Israel_files/2015-10-04 18:43 -  
[TXT]Islamic Headscarf Ban Debate Hits Australia.htm2012-10-01 17:31 3.3K 
[DIR]Islamic Headscarf Ban Debate Hits Australia_files/2015-10-04 18:43 -  
[TXT]Islamic Wisdom - 'Rapist' Jailed, 'Victim' Executed.htm2012-10-01 17:27 2.4K 
[DIR]Islamic Wisdom - 'Rapist' Jailed, 'Victim' Executed_files/2015-10-04 18:43 -  
[TXT]Islamists Throng in Europe's Powder Keg.htm2012-10-01 17:33 3.2K 
[DIR]Islamists Throng in Europe's Powder Keg_files/2015-10-04 18:43 -  
[TXT]Islam versus Christianity – A reply to The Pope!.htm2012-10-01 17:33 59K 
[DIR]Islam versus Christianity – A reply to The Pope!_files/2015-10-04 18:43 -  
[TXT]Israel's End Game Gambit Failure_ Hamas Refuses to Allow Israel to Exist.html2012-10-01 17:32 63K 
[TXT]Israel's Interior Minister - 'Stop Spitting on Christians'.htm2012-10-01 17:29 8.0K 
[DIR]Israel's Interior Minister - 'Stop Spitting on Christians'_files/2015-10-04 18:43 -  
[TXT]Israel's Secret Weapon.htm2012-10-01 17:33 43K 
[TXT]Israel's Sex-Slave Industry Soars.htm2012-10-01 17:28 2.9K 
[DIR]Israel's Sex-Slave Industry Soars_files/2015-10-04 18:43 -  
[TXT]Israel - Beyond Good and Evil.htm2012-10-01 17:27 5.7K 
[DIR]Israel - Beyond Good and Evil_files/2015-10-04 18:43 -  
[TXT]Israel - New Party Urges Expulsion of Non-Jews.htm2012-10-01 17:32 3.6K 
[DIR]Israel - New Party Urges Expulsion of Non-Jews_files/2015-10-04 18:43 -  
[TXT]Israel - Poll Shows 64 Percent of Israeli Jews Favor Ethnic Cleansing.htm2012-10-01 17:29 3.2K 
[DIR]Israel - Poll Shows 64 Percent of Israeli Jews Favor Ethnic Cleansing_files/2015-10-04 18:43 -  
[TXT]Israel - Was BBC's Peter Hounam Arrested as Punishment.htm2012-10-01 17:33 4.7K 
[DIR]Israel - Was BBC's Peter Hounam Arrested as Punishment_files/2015-10-04 18:43 -  
[TXT]Israel Honors Jewish Terrorists Who Attacked America.htm2012-10-01 17:31 17K 
[DIR]Israel Honors Jewish Terrorists Who Attacked America_files/2015-10-04 18:43 -  
[TXT]Israel Loan Program Limited to Jews.htm2012-10-01 17:32 2.8K 
[DIR]Israel Loan Program Limited to Jews_files/2015-10-04 18:43 -  
[   ]IsraelLobbyAndUSForeignPolicy.pdf2012-10-01 17:30 1.4M 
[TXT]Israel Lobby Denial.htm2012-10-01 17:31 14K 
[DIR]Israel Lobby Denial_files/2015-10-04 18:43 -  
[TXT]Israel Pushing U.S. to Bomb Iran.htm2012-10-01 17:32 4.3K 
[DIR]Israel Pushing U.S. to Bomb Iran_files/2015-10-04 18:43 -  
[   ]IsraelSexSlaveTrade.pdf2012-10-01 17:28 51K 
[   ]IsraelSexSlaveTraffic.pdf2012-10-01 17:27 956K 
[TXT]Israel Wants IAEA to Ignore its Nuclear Arsenal, Concentrate on Iran.htm2012-10-01 17:28 3.9K 
[DIR]Israel Wants IAEA to Ignore its Nuclear Arsenal, Concentrate on Iran_files/2015-10-04 18:43 -  
[TXT]Israel Will Continue to Hurl Terror Bombs into Gaza Homes, Producing Wounded and Dying Children.html2012-10-01 17:27 45K 
[TXT]Israeli-Sponsored Educational Program for NY Schools.htm2012-10-01 17:31 2.5K 
[DIR]Israeli-Sponsored Educational Program for NY Schools_files/2015-10-04 18:43 -  
[TXT]Israeli Gangster Shot Dead in Russia.htm2012-10-01 17:28 2.5K 
[DIR]Israeli Gangster Shot Dead in Russia_files/2015-10-04 18:43 -  
[TXT]Israeli Minister Calls for Nasrallah's Death.htm2012-10-01 17:33 2.7K 
[DIR]Israeli Minister Calls for Nasrallah's Death_files/2015-10-04 18:43 -  
[TXT]Israeli Nuclear Whistleblower Vanunu Speaks.htm2012-10-01 17:29 3.7K 
[DIR]Israeli Nuclear Whistleblower Vanunu Speaks_files/2015-10-04 18:43 -  
[TXT]Israeli PM's party plagiarizes from Texas Democrats.htm2012-10-01 17:32 23K 
[DIR]Israeli PM's party plagiarizes from Texas Democrats_files/2015-10-04 18:43 -  
[TXT]IsraeliPrimeMinisterDeclaresJewWarOnIranAndSyria.html2012-10-01 17:32 28K 
[DIR]IsraeliPrimeMinisterDeclaresJewWarOnIranAndSyria_files/2015-10-04 18:43 -  
[TXT]Israeli Sexpionage - The McGreevey, Condit and Clinton Affairs.htm2012-10-01 17:34 12K 
[DIR]Israeli Sexpionage - The McGreevey, Condit and Clinton Affairs_files/2015-10-04 18:43 -  
[TXT]Israeli Sniper Assassinates Two Children.htm2012-10-01 17:27 3.1K 
[DIR]Israeli Sniper Assassinates Two Children_files/2015-10-04 18:43 -  
[TXT]Israeli Spying - The Mother of All Scandals.htm2012-10-01 17:30 2.8K 
[DIR]Israeli Spying - The Mother of All Scandals_files/2015-10-04 18:43 -  
[TXT]Israeli Website Exposes Jewish Extremism!.htm2012-10-01 17:29 13K 
[DIR]Israeli Website Exposes Jewish Extremism!_files/2015-10-04 18:43 -  
[TXT]Israel in Hot Water Over New Zealand Spies.htm2012-10-01 17:28 3.9K 
[DIR]Israel in Hot Water Over New Zealand Spies_files/2015-10-04 18:43 -  
[TXT]Israelis Among the Holocaust Deniers.htm2012-10-01 17:32 2.4K 
[DIR]Israelis Among the Holocaust Deniers_files/2015-10-04 18:43 -  
[TXT]Israelis Launch Voting Guide.htm2012-10-01 17:31 3.5K 
[DIR]Israelis Launch Voting Guide_files/2015-10-04 18:43 -  
[TXT]Israelis Win Contract To Secure US Borders.htm2012-10-01 17:28 22K 
[DIR]Israelis Win Contract To Secure US Borders_files/2015-10-04 18:43 -  
[TXT]Israeli troops seize million dollars in bank raids across West Bank.htm2012-10-01 17:33 2.1K 
[DIR]Israeli troops seize million dollars in bank raids across West Bank_files/2015-10-04 18:43 -  
[TXT]It's 1984 in Massachusetts – And Big Brother Is Gay.htm2012-10-01 17:30 16K 
[DIR]It's 1984 in Massachusetts – And Big Brother Is Gay_files/2015-10-04 18:43 -  
[TXT]It's Coming to America, Too.htm2012-10-01 17:33 6.2K 
[DIR]It's Coming to America, Too_files/2015-10-04 18:43 -  
[TXT]It's the Genes, Stupid!.htm2012-10-01 17:31 22K 
[DIR]It's the Genes, Stupid!_files/2015-10-04 18:43 -  
[   ]IzzySecretServicesTruth.rtf2012-10-01 17:32 67K 
[   ]IzzySpyRing.pdf2012-10-01 17:30 2.0M 
[TXT]JB Cash - 2006-01-05 - Death of a Hero.htm2012-10-01 17:29 21K 
[DIR]JB Cash - 2006-01-05 - Death of a Hero_files/2015-10-04 18:43 -  
[TXT]J Dub Gettin’ Funky in Durham.htm2012-10-01 17:32 3.5K 
[DIR]J Dub Gettin’ Funky in Durham_files/2015-10-04 18:43 -  
[TXT]JEWISH CRIME.htm2012-10-01 17:27 126K 
[TXT]Jagger Rejects Kabbalah after Extortion Attempt.htm2012-10-01 17:29 2.8K 
[DIR]Jagger Rejects Kabbalah after Extortion Attempt_files/2015-10-04 18:43 -  
[TXT]James and Cindy; Progress and Hope.htm2012-10-01 17:31 23K 
[DIR]James and Cindy; Progress and Hope_files/2015-10-04 18:43 -  
[   ]Jan01.pdf2012-10-01 17:28 747K 
[   ]Jan02.pdf2012-10-01 17:28 1.2M 
[   ]Jan03.pdf2012-10-01 17:32 1.6M 
[   ]Jan04.pdf2012-10-01 17:27 918K 
[TXT]Janis Ian - 2002-09-16 - THE INTERNET DEBACLE – AN ALTERNATIVE VIEW.htm2012-10-01 17:32 33K 
[DIR]Janis Ian - 2002-09-16 - THE INTERNET DEBACLE – AN ALTERNATIVE VIEW_files/2015-10-04 18:43 -  
[TXT]Jeff A. Taylor - 2006-07-24 - Rah-Rah IDF.htm2012-10-01 17:31 3.4K 
[DIR]Jeff A. Taylor - 2006-07-24 - Rah-Rah IDF_files/2015-10-04 18:43 -  
[TXT]Jerry Falwell Now Supports 'Gay' Rights.htm2012-10-01 17:34 5.0K 
[DIR]Jerry Falwell Now Supports 'Gay' Rights_files/2015-10-04 18:43 -  
[   ]JewDefectorWarnAmerica.pdf2012-10-01 17:32 32K 
[   ]JewExpulsions.pdf2012-10-01 17:28 17K 
[   ]JewImmigrationPolicy.pdf2012-10-01 17:34 163K 
[   ]JewReligionInfluenceToday.pdf2012-10-01 17:33 1.5M 
[   ]JewRoleInBolshevikRevolution.pdf2012-10-01 17:32 119K 
[TXT]Jew Threatens LA With New 9-11.htm2012-10-01 17:32 7.0K 
[DIR]Jew Threatens LA With New 9-11_files/2015-10-04 18:43 -  
[DIR]JewWatch/2012-10-01 17:34 -  
[TXT]Jewish 'Muslim' Threatens West with Genocide.htm2012-10-01 17:27 4.1K 
[DIR]Jewish 'Muslim' Threatens West with Genocide_files/2015-10-04 18:43 -  
[TXT]Jewish Academic Blasts Middle-class Whites for Not 'Integrating' Kids.htm2012-10-01 17:31 5.1K 
[DIR]Jewish Academic Blasts Middle-class Whites for Not 'Integrating' Kids_files/2015-10-04 18:43 -  
[TXT]Jewish Anti-Gentile Hatred in Porn Industry.htm2012-10-01 17:29 4.6K 
[DIR]Jewish Anti-Gentile Hatred in Porn Industry_files/2015-10-04 18:43 -  
[TXT]Jewish Censors Seek to Ban Dissident White Historian.htm2012-10-01 17:33 2.4K 
[DIR]Jewish Censors Seek to Ban Dissident White Historian_files/2015-10-04 18:43 -  
[TXT]Jewish Genetic Diseases.htm2012-10-01 17:32 39K 
[TXT]Jewish Genetic Diseases 2.htm2012-10-01 17:31 26K 
[DIR]Jewish Genetic Diseases 2_files/2015-10-04 18:43 -  
[DIR]Jewish Genetic Diseases_files/2015-10-04 18:43 -  
[TXT]Jewish Hate, the Media, and the ADL.htm2012-10-01 17:31 23K 
[   ]JewishHistoryJewishReligion.pdf2012-10-01 17:28 421K 
[TXT]Jewish Lawyer Edward Fagan to Sue African Marxists.htm2012-10-01 17:29 4.3K 
[DIR]Jewish Lawyer Edward Fagan to Sue African Marxists_files/2015-10-04 18:43 -  
[TXT]Jewish Leader Calls On Zionists To Kill All Palestinian Males.htm2012-10-01 17:31 25K 
[DIR]Jewish Leader Calls On Zionists To Kill All Palestinian Males_files/2015-10-04 18:43 -  
[TXT]Jewish Mafia Expands White Slave Trade to London.htm2012-10-01 17:30 2.4K 
[DIR]Jewish Mafia Expands White Slave Trade to London_files/2015-10-04 18:43 -  
[TXT]Jewish Porn King May Have Skipped to Israel.htm2012-10-01 17:31 3.4K 
[DIR]Jewish Porn King May Have Skipped to Israel_files/2015-10-04 18:43 -  
[   ]JewishRitualMurder.pdf2012-10-01 17:31 302K 
[TXT]Jewish Support for Open Borders - Is it Biological.htm2012-10-01 17:27 8.8K 
[DIR]Jewish Support for Open Borders - Is it Biological_files/2015-10-04 18:43 -  
[TXT]Jewish Supremacist Michael Chertoff Named Head of Homeland Security.htm2012-10-01 17:31 10K 
[DIR]Jewish Supremacist Michael Chertoff Named Head of Homeland Security_files/2015-10-04 18:43 -  
[TXT]Jewish Supremacists Shaping Election of UN Secretary General.htm2012-10-01 17:32 9.0K 
[DIR]Jewish Supremacists Shaping Election of UN Secretary General_files/2015-10-04 18:43 -  
[   ]JewishTalmudOrg.PDF2012-10-01 17:33 1.1M 
[TXT]Jewish Terrorist Gets Prison.htm2012-10-01 17:30 3.3K 
[DIR]Jewish Terrorist Gets Prison_files/2015-10-04 18:43 -  
[TXT]Jewish Usury and Finance Capital.htm2012-10-01 17:27 40K 
[DIR]Jewish Usury and Finance Capital_files/2015-10-04 18:43 -  
[TXT]Jewish Voters Object to New Polling Place.htm2012-10-01 17:33 2.8K 
[TXT]Jewish Voters Object to New Polling Place2.htm2012-10-01 17:33 7.3K 
[DIR]Jewish Voters Object to New Polling Place2_files/2015-10-04 18:43 -  
[DIR]Jewish Voters Object to New Polling Place_files/2015-10-04 18:43 -  
[TXT]Jewish WMD Whistleblower Vanunu Released But Not Free.htm2012-10-01 17:31 10K 
[DIR]Jewish WMD Whistleblower Vanunu Released But Not Free_files/2015-10-04 18:43 -  
[   ]JewishWarOfSurvival.pdf2012-10-01 17:31 182K 
[   ]JewishWorldConquest.rtf2012-10-01 17:28 126K 
[TXT]Jewish rabbi calls for extermination of all Palestinian males.htm2012-10-01 17:33 7.2K 
[DIR]Jewish rabbi calls for extermination of all Palestinian males_files/2015-10-04 18:43 -  
[TXT]Jews - A Religious Community, a People, or a Race.htm2012-10-01 17:33 5.9K 
[DIR]Jews - A Religious Community, a People, or a Race_files/2015-10-04 18:43 -  
[TXT]Jews Admit - Iran Is Israel’s “Greatest Threat”.htm2012-10-01 17:31 4.1K 
[   ]JewsAndTheirLies.pdf2012-10-01 17:31 265K 
[TXT]Jews And Their Zionist Views.htm2012-10-01 17:30 14K 
[   ]JewsAtSteeringWheel.pdf2012-10-01 17:28 109K 
[   ]JewsIQ.pdf2012-10-01 17:31 1.7M 
[TXT]Jews Push Homosexual 'Reality' TV Shows.htm2012-10-01 17:30 3.6K 
[TXT]Jews Relentless In Pursuit of Internet Censorship.htm2012-10-01 17:34 13K 
[DIR]Jews Relentless In Pursuit of Internet Censorship_files/2015-10-04 18:43 -  
[TXT]Jingle Jam Chaos Closes Minnesota Mall.htm2012-10-01 17:28 3.6K 
[DIR]Jingle Jam Chaos Closes Minnesota Mall_files/2015-10-04 18:43 -  
[TXT]John Barleycorn.htm2012-10-01 17:30 3.8K 
[DIR]John Barleycorn_files/2015-10-04 18:43 -  
[TXT]John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency.htm2012-10-01 17:33 26K 
[TXT]John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency.txt2012-10-01 17:28 18K 
[DIR]John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency_files/2015-10-04 18:43 -  
[TXT]John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution, continued.htm2012-10-01 17:27 61K 
[DIR]John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution, continued_files/2015-10-04 18:43 -  
[TXT]John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution.htm2012-10-01 17:33 75K 
[DIR]John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution_files/2015-10-04 18:43 -  
[TXT]John H. Campbell - The Moral Imperative of Our Future Evolution.htm2012-10-01 17:31 108K 
[DIR]John H. Campbell - The Moral Imperative of Our Future Evolution_files/2015-10-04 18:43 -  
[   ]JohnJayJewel.pdf2012-10-01 17:32 102K 
[TXT]John Moffat - 2005-08-15 - How Whites Won and Lost a Continent.txt2012-10-01 17:30 15K 
[TXT]John Tyndall - An Anagogical View of Empire.htm2012-10-01 17:28 8.5K 
[DIR]John Tyndall - An Anagogical View of Empire_files/2015-10-04 18:43 -  
[TXT]Journalist Held In Dungeon Of Filth.htm2012-10-01 17:28 1.9K 
[DIR]Journalist Held In Dungeon Of Filth_files/2015-10-04 18:43 -  
[   ]JudaismInMusic.pdf2012-10-01 17:31 73K 
[TXT]Judea declares war on Germany.htm2012-10-01 17:31 29K 
[DIR]Judea declares war on Germany_files/2015-10-04 18:43 -  
[TXT]Judeo-Fascism.htm2012-10-01 17:27 3.7K 
[DIR]Judeo-Fascism_files/2015-10-04 18:43 -  
[   ]Jul02.pdf2012-10-01 17:34 1.7M 
[   ]Jul03.pdf2012-10-01 17:34 779K 
[   ]Jul04.pdf2012-10-01 17:33 749K 
[   ]July01.pdf2012-10-01 17:28 773K 
[   ]Jun01.pdf2012-10-01 17:33 1.2M 
[   ]Jun02.pdf2012-10-01 17:29 1.4M 
[   ]Jun03.pdf2012-10-01 17:31 684K 
[   ]Jun04.pdf2012-10-01 17:31 1.0M 
[TXT]Jury Selection to Be Moved in Bloodbath Trial.htm2012-10-01 17:33 2.7K 
[DIR]Jury Selection to Be Moved in Bloodbath Trial_files/2015-10-04 18:43 -  
[   ]JustificationOfTerror.pdf2012-10-01 17:34 13K 
[   ]KKKChristmasCardDOUBLEfold.pdf2012-10-01 17:31 292K 
[   ]KKKChristmasCardSINGLEfold.pdf2012-10-01 17:34 316K 
[   ]KULA.pdf2012-10-01 17:27 5.8M 
[TXT]Kaballah Crazy!.htm2012-10-01 17:30 3.6K 
[DIR]Kaballah Crazy!_files/2015-10-04 18:43 -  
[TXT]Kabbalah Red String Market Threatened.htm2012-10-01 17:31 3.4K 
[DIR]Kabbalah Red String Market Threatened_files/2015-10-04 18:43 -  
[   ]Kalevala.pdf2012-10-01 17:31 1.0M 
[TXT]Kathleen Christiso - 2006-09-12 - The Coming Collapse of Zionism.htm2012-10-01 17:30 33K 
[DIR]Kathleen Christiso - 2006-09-12 - The Coming Collapse of Zionism_files/2015-10-04 18:43 -  
[TXT]Katrina, Iraq, and the Know-It-All Syndrome.htm2012-10-01 17:34 3.7K 
[DIR]Katrina, Iraq, and the Know-It-All Syndrome_files/2015-10-04 18:43 -  
[TXT]Katrina - Neo-con Pals Rake in the Dough.htm2012-10-01 17:32 3.5K 
[DIR]Katrina - Neo-con Pals Rake in the Dough_files/2015-10-04 18:43 -  
[TXT]Katrina Black Tells Fox You Owe Him.htm2012-10-01 17:28 5.2K 
[DIR]Katrina Black Tells Fox You Owe Him_files/2015-10-04 18:43 -  
[TXT]Katrina Evacuee Charged with Child Murder.htm2012-10-01 17:31 3.5K 
[DIR]Katrina Evacuee Charged with Child Murder_files/2015-10-04 18:43 -  
[TXT]Katrina Evacuees Binge on Cape Cod.htm2012-10-01 17:28 4.1K 
[DIR]Katrina Evacuees Binge on Cape Cod_files/2015-10-04 18:43 -  
[TXT]Katrina Students Spark Constitutional Debate.htm2012-10-01 17:29 3.4K 
[DIR]Katrina Students Spark Constitutional Debate_files/2015-10-04 18:43 -  
[TXT]Katrina Tensions - School Official Resigns over Remarks.htm2012-10-01 17:27 3.4K 
[DIR]Katrina Tensions - School Official Resigns over Remarks_files/2015-10-04 18:43 -  
[TXT]Katrina Threatens Croatian-American Tradition.htm2012-10-01 17:31 4.4K 
[DIR]Katrina Threatens Croatian-American Tradition_files/2015-10-04 18:43 -  
[TXT]Katrina Threatens to Swamp Utah.htm2012-10-01 17:28 5.6K 
[DIR]Katrina Threatens to Swamp Utah_files/2015-10-04 18:43 -  
[TXT]Katrina Unleashes HIV+ Horde.htm2012-10-01 17:27 3.7K 
[DIR]Katrina Unleashes HIV+ Horde_files/2015-10-04 18:43 -  
[TXT]Katrina Victims Unwelcome in Some Towns.htm2012-10-01 17:33 3.8K 
[DIR]Katrina Victims Unwelcome in Some Towns_files/2015-10-04 18:43 -  
[TXT]Katrina and the Black Tsunami.htm2012-10-01 17:30 29K 
[DIR]Katrina and the Black Tsunami_files/2015-10-04 18:43 -  
[   ]Keitel.pdf2012-10-01 17:32 1.2M 
[TXT]Kenya - Black Priest Kills White Roman Catholic Bishop.htm2012-10-01 17:31 2.9K 
[DIR]Kenya - Black Priest Kills White Roman Catholic Bishop_files/2015-10-04 18:43 -  
[TXT]Kill Arabs, Cry Anti-Semitism.htm2012-10-01 17:34 4.5K 
[DIR]Kill Arabs, Cry Anti-Semitism_files/2015-10-04 18:43 -  
[TXT]Kill a Cracker Day.htm2012-10-01 17:30 2.2K 
[TXT]Killer Plays Race Card.htm2012-10-01 17:27 6.9K 
[DIR]Killer Plays Race Card_files/2015-10-04 18:43 -  
[TXT]Kill the Christians.htm2012-10-01 17:28 3.3K 
[DIR]Kill the Christians_files/2015-10-04 18:43 -  
[TXT]Kirkby TV Covers Reconquista.htm2012-10-01 17:33 3.3K 
[DIR]Kirkby TV Covers Reconquista_files/2015-10-04 18:43 -  
[   ]Klassen.pdf2012-10-01 17:30 390K 
[   ]KlassenCD-Insert.pdf2012-10-01 17:33 86K 
[   ]KlassenCD-ReOrderForm.pdf2012-10-01 17:30 69K 
[   ]KlassenCD-TrayLiner.pdf2012-10-01 17:30 578K 
[TXT]Kook Conspiracy Theories - Reject Them.htm2012-10-01 17:33 11K 
[DIR]Kook Conspiracy Theories - Reject Them_files/2015-10-04 18:43 -  
[   ]KosherFoodTax.pdf2012-10-01 17:28 3.5M 
[TXT]Kosovo - A Dangerous Cosmetic Salon.htm2012-10-01 17:29 2.4K 
[DIR]Kosovo - A Dangerous Cosmetic Salon_files/2015-10-04 18:43 -  
[TXT]Kurdish soldiers trained by Israelis.htm2012-10-01 17:28 4.5K 
[   ]LFS-BOOK-6.2.pdf2012-10-01 17:31 797K 
[   ]LFS - essential_prereading2012-10-01 17:30 13K 
[TXT]La Pauvre Petite - Schoolgirl abduction-murder rivets France.htm2012-10-01 17:31 4.8K 
[DIR]La Pauvre Petite - Schoolgirl abduction-murder rivets France_files/2015-10-04 18:43 -  
[TXT]La Raza List of Corporate Traitors.htm2012-10-01 17:28 9.1K 
[DIR]La Raza List of Corporate Traitors_files/2015-10-04 18:43 -  
[TXT]Lamb Gaede - 11-year-old White Girl Stands for Truth in California.htm2012-10-01 17:31 5.8K 
[DIR]Lamb Gaede - 11-year-old White Girl Stands for Truth in California_files/2015-10-04 18:43 -  
[TXT]Lambing Flat.htm2012-10-01 17:33 8.9K 
[DIR]Lambing Flat_files/2015-10-04 18:43 -  
[TXT]Land Of Dope And Jewry.htm2012-10-01 17:33 23K 
[DIR]Land Of Dope And Jewry_files/2015-10-04 18:43 -  
[TXT]Lapdance King, Lawyer Indicted in 'Mafia' Probe.htm2012-10-01 17:34 5.1K 
[DIR]Lapdance King, Lawyer Indicted in 'Mafia' Probe_files/2015-10-04 18:43 -  
[   ]LatviaYearOfHorror.pdf2012-10-01 17:31 6.6M 
[TXT]Law Enforcement Embattled in New Orleans.htm2012-10-01 17:31 2.9K 
[DIR]Law Enforcement Embattled in New Orleans_files/2015-10-04 18:43 -  
[   ]LeaderlessResistance.pdf2012-10-01 17:31 53K 
[   ]LearningAboutHomos.pdf2012-10-01 17:31 1.2M 
[TXT]Leftist Violence Flares at Norwegian Election Event.htm2012-10-01 17:33 2.6K 
[DIR]Leftist Violence Flares at Norwegian Election Event_files/2015-10-04 18:43 -  
[TXT]Letter - A Father Pleads for His Son's Future.htm2012-10-01 17:34 4.6K 
[DIR]Letter - A Father Pleads for His Son's Future_files/2015-10-04 18:43 -  
[TXT]Letter from Atlanta - The Seamy Gold Club Trial.htm2012-10-01 17:29 20K 
[DIR]Letter from Atlanta - The Seamy Gold Club Trial_files/2015-10-04 18:43 -  
[   ]LeuchterReport.pdf2012-10-01 17:30 2.2M 
[   ]Levithian.pdf2012-10-01 17:29 1.0M 
[   ]LiarWeasel.pdf2012-10-01 17:33 63K 
[   ]Libby - press_advisory_1028.pdf2012-10-01 17:28 34K 
[TXT]Liberating America From Israel.htm2012-10-01 17:33 9.6K 
[DIR]Liberating America From Israel_files/2015-10-04 18:43 -  
[   ]LifeIn3rdReich.pdf2012-10-01 17:28 56K 
[   ]LifeInHitlersGermany.pdf2012-10-01 17:28 446K 
[TXT]Light for Nations - A Short History of the Jews in the Modern World.txt2012-10-01 17:32 60K 
[TXT]Links Of White Interest.txt2012-10-01 17:31 4.9K 
[   ]Linux+IPv6-HOWTO.pdf2012-10-01 17:30 769K 
[TXT]Lisa Rad - 2006-02-15 - Fall of the Fourth Reich.htm2012-10-01 17:31 51K 
[DIR]Lisa Rad - 2006-02-15 - Fall of the Fourth Reich_files/2015-10-04 18:43 -  
[TXT]London - Jewish Mafia Loses Three Soldiers.htm2012-10-01 17:27 6.5K 
[DIR]London - Jewish Mafia Loses Three Soldiers_files/2015-10-04 18:43 -  
[TXT]London Mayor Challenges Suspension.htm2012-10-01 17:28 2.7K 
[DIR]London Mayor Challenges Suspension_files/2015-10-04 18:43 -  
[TXT]Looking to Belong.htm2012-10-01 17:30 6.5K 
[   ]LordOfTheRings.pdf2012-10-01 17:30 13M 
[   ]Louis Beam - Leaderless Resistance - 1983.pdf2012-10-01 17:31 53K 
[TXT]Louisiana - Town's First Black Police Chief Charged in Crack Probe.htm2012-10-01 17:34 4.5K 
[DIR]Louisiana - Town's First Black Police Chief Charged in Crack Probe_files/2015-10-04 18:43 -  
[TXT]Louisiana National Guard Troops Watch Katrina from Iraq.htm2012-10-01 17:33 3.1K 
[DIR]Louisiana National Guard Troops Watch Katrina from Iraq_files/2015-10-04 18:43 -  
[TXT]Louisiana Senator Threatens To Assault Bush.htm2012-10-01 17:30 4.4K 
[DIR]Louisiana Senator Threatens To Assault Bush_files/2015-10-04 18:43 -  
[TXT]Low-paid illegal work force has little impact on prices - 2.htm2012-10-01 17:33 33K 
[DIR]Low-paid illegal work force has little impact on prices - 2_files/2015-10-04 18:43 -  
[TXT]Low-paid illegal work force has little impact on prices.htm2012-10-01 17:31 12K 
[DIR]Low-paid illegal work force has little impact on prices_files/2015-10-04 18:43 -  
[TXT]M. P. Shiel - 2006-03-07 - Equality, Democracy, and their Killing Fields.htm2012-10-01 17:31 17K 
[DIR]M. P. Shiel - 2006-03-07 - Equality, Democracy, and their Killing Fields_files/2015-10-04 18:43 -  
[   ]MBOE.pdf2012-10-01 17:30 5.7M 
[   ]MLK101.pdf2012-10-01 17:33 277K 
[TXT]MY FAREWELL TO ISRAEL.htm2012-10-01 17:31 266K 
[DIR]MY FAREWELL TO ISRAEL_files/2015-10-04 18:43 -  
[   ]MacQueen.pdf2012-10-01 17:31 692K 
[   ]MacWorld US - 2007 04.pdf2012-10-01 17:33 23M 
[   ]Madame_Guillotine.pdf2012-10-01 17:31 115K 
[TXT]Madonna Listed Among America's 'Most Powerful Jews'.htm2012-10-01 17:30 4.9K 
[DIR]Madonna Listed Among America's 'Most Powerful Jews'_files/2015-10-04 18:43 -  
[   ]MagnaCarta.pdf2012-10-01 17:27 30K 
[TXT]Make Your Cheque out to God-Cash.htm2012-10-01 17:29 3.4K 
[TXT]Mali - Africans Still Practice Human Sacrifice.htm2012-10-01 17:34 8.3K 
[DIR]Mali - Africans Still Practice Human Sacrifice_files/2015-10-04 18:43 -  
[   ]MalleusAcrobat.pdf2012-10-01 17:31 2.4M 
[   ]ManagementSummary-V2.2.pdf2012-10-01 17:33 1.1M 
[   ]Mar01.pdf2012-10-01 17:31 895K 
[   ]Mar02.pdf2012-10-01 17:31 1.4M 
[   ]Mar03.pdf2012-10-01 17:31 1.0M 
[   ]Mar04.pdf2012-10-01 17:31 1.2M 
[   ]Mar06.pdf2012-10-01 17:32 807K 
[TXT]Marcus Epstein and Michelle Malkin.htm2012-10-01 17:33 25K 
[DIR]Marcus Epstein and Michelle Malkin_files/2015-10-04 18:43 -  
[   ]MaresNest.pdf2012-10-01 17:32 1.1M 
[TXT]Marian Evans -- Catastrophe in Kansas City.htm2012-10-01 17:31 81K 
[DIR]Marian Evans -- Catastrophe in Kansas City_files/2015-10-04 18:43 -  
[TXT]Mariel Deja Vu.htm2012-10-01 17:33 4.1K 
[DIR]Mariel Deja Vu_files/2015-10-04 18:43 -  
[TXT]Mark Weber - 2004-07-09 - ADL Strongman Panics at Break in 'Holocaust' Party Line.txt2012-10-01 17:28 19K 
[TXT]Mark Weber - 2006-02-10 - Holocaust Survivor Memoir Exposed as Fraud.htm2012-10-01 17:32 7.6K 
[DIR]Mark Weber - 2006-02-10 - Holocaust Survivor Memoir Exposed as Fraud_files/2015-10-04 18:43 -  
[TXT]Mark Weber - 2006-03-16 - The Jewish Role in the Bolshevik Revolution and Russia's Early Soviet Regime.htm2012-10-01 17:32 18K 
[DIR]Mark Weber - 2006-03-16 - The Jewish Role in the Bolshevik Revolution and Russia's Early Soviet Regime_files/2015-10-04 18:43 -  
[   ]Marshall - The Last Circle (unpublished manuscript on the Octopus mafia organization) (1994).pdf2012-10-01 17:32 472K 
[TXT]Marshals - Innocent People Placed On 'Watch List' To Meet Quota.htm2012-10-01 17:33 3.5K 
[DIR]Marshals - Innocent People Placed On 'Watch List' To Meet Quota_files/2015-10-04 18:43 -  
[TXT]Marxists Gamble on Geeks.htm2012-10-01 17:28 12K 
[DIR]Marxists Gamble on Geeks_files/2015-10-04 18:43 -  
[TXT]MaryPhaghanSong.htm2012-10-01 17:33 9.5K 
[DIR]MaryPhaghanSong_files/2015-10-04 18:43 -  
[TXT]Mass Grave Containing Kosovo Serbs Found.htm2012-10-01 17:28 2.9K 
[DIR]Mass Grave Containing Kosovo Serbs Found_files/2015-10-04 18:43 -  
[TXT]Mass Grave of Massacred Poles Found in Ukraine.htm2012-10-01 17:29 26K 
[DIR]Mass Grave of Massacred Poles Found in Ukraine_files/2015-10-04 18:43 -  
[TXT]Massive Debt Could Trigger Great Depression.htm2012-10-01 17:32 4.5K 
[TXT]Matthew Downing - 2006-03-24 - Massachusetts - Pro-White Outreach Frustrates Local Media, ADL.htm2012-10-01 17:33 16K 
[DIR]Matthew Downing - 2006-03-24 - Massachusetts - Pro-White Outreach Frustrates Local Media, ADL_files/2015-10-04 18:43 -  
[TXT]Matthew Hale - Justice Denied.htm2012-10-01 17:31 13K 
[DIR]Matthew Hale - Justice Denied_files/2015-10-04 18:43 -  
[   ]May01.pdf2012-10-01 17:30 792K 
[   ]May02.pdf2012-10-01 17:27 1.5M 
[   ]May03.pdf2012-10-01 17:29 1.0M 
[   ]May04.pdf2012-10-01 17:33 1.2M 
[TXT]Media Note - 'Michael Savage' Lashes Out Against Nick Berg and His Family.htm2012-10-01 17:31 2.5K 
[DIR]Media Note - 'Michael Savage' Lashes Out Against Nick Berg and His Family_files/2015-10-04 18:43 -  
[TXT]Medicating heretics.htm2012-10-01 17:33 9.1K 
[DIR]Medicating heretics_files/2015-10-04 18:43 -  
[   ]MeinKampf.pdf2012-10-01 17:33 1.2M 
[TXT]Mel Gibson's Anti-Zionist Priest Dies.htm2012-10-01 17:31 8.0K 
[DIR]Mel Gibson's Anti-Zionist Priest Dies_files/2015-10-04 18:43 -  
[TXT]Mel Gibson Denounces Jews' War.htm2012-10-01 17:33 24K 
[DIR]Mel Gibson Denounces Jews' War_files/2015-10-04 18:43 -  
[   ]Melchizedek_Drunvalo_#BF2F1.pdf2012-10-01 17:28 3.9M 
[TXT]Memo Proves Brown Paid for Chertoff's Incompetence.htm2012-10-01 17:33 3.6K 
[DIR]Memo Proves Brown Paid for Chertoff's Incompetence_files/2015-10-04 18:43 -  
[TXT]Merry Christmas -- and on to Victory!.htm2012-10-01 17:29 11K 
[DIR]Merry Christmas -- and on to Victory!_files/2015-10-04 18:43 -  
[TXT]Merry Orthodox Christmas.htm2012-10-01 17:28 2.5K 
[TXT]Mestizo Gangs Control the Suburbs.htm2012-10-01 17:30 2.6K 
[DIR]Mestizo Gangs Control the Suburbs_files/2015-10-04 18:43 -  
[TXT]Mestizos too violent for open debate, crowd control impossible.htm2012-10-01 17:28 2.7K 
[DIR]Mestizos too violent for open debate, crowd control impossible_files/2015-10-04 18:43 -  
[TXT]Mexico Conquers Texas.htm2012-10-01 17:33 2.4K 
[DIR]Mexico Conquers Texas_files/2015-10-04 18:43 -  
[TXT]Mexico Ups the Ante in Conflict with American Blacks.htm2012-10-01 17:33 2.3K 
[DIR]Mexico Ups the Ante in Conflict with American Blacks_files/2015-10-04 18:43 -  
[TXT]Michael Chertoff - 'Trust Us'.htm2012-10-01 17:31 5.8K 
[DIR]Michael Chertoff - 'Trust Us'_files/2015-10-04 18:43 -  
[TXT]Michael O'Meara - 2005-11-05 - Katrina's Intimation of the End - Afterthoughts on the Impending Catastrophe.txt2012-10-01 17:32 16K 
[TXT]Middle Class Families in Worse Shape Than Ever, Study Finds.htm2012-10-01 17:31 2.7K 
[DIR]Middle Class Families in Worse Shape Than Ever, Study Finds_files/2015-10-04 18:43 -  
[   ]Milch.pdf2012-10-01 17:31 2.3M 
[   ]MillerPuckette Book 06-2007.pdf2012-10-01 17:28 1.9M 
[TXT]Minnesota Shocker - Black Muslim Wins Primary.htm2012-10-01 17:29 3.6K 
[DIR]Minnesota Shocker - Black Muslim Wins Primary_files/2015-10-04 18:43 -  
[TXT]Minnesotans Love Non-Whites.htm2012-10-01 17:27 2.2K 
[TXT]Miscegenator Murders White 'Girlfriend' and Unborn Child.htm2012-10-01 17:29 3.3K 
[DIR]Miscegenator Murders White 'Girlfriend' and Unborn Child_files/2015-10-04 18:43 -  
[TXT]Mission Fights Eastern European Sex Slave Traffic.htm2012-10-01 17:33 3.8K 
[DIR]Mission Fights Eastern European Sex Slave Traffic_files/2015-10-04 18:43 -  
[TXT]Mistrial for Accused Jewish Mafia Godfather.htm2012-10-01 17:33 3.4K 
[DIR]Mistrial for Accused Jewish Mafia Godfather_files/2015-10-04 18:43 -  
[   ]Mogadishu Redux -- The Irrepressible Genetics Of Simian Negroids.nws2012-10-01 17:33 111K 
[TXT]Mom Gives Kids Dose O’ Diversity.htm2012-10-01 17:31 2.4K 
[DIR]Mom Gives Kids Dose O’ Diversity_files/2015-10-04 18:43 -  
[   ]MoneyChangers.pdf2012-10-01 17:31 172K 
[TXT]More 'Racist' AIDS Statistics.htm2012-10-01 17:31 2.6K 
[DIR]More 'Racist' AIDS Statistics_files/2015-10-04 18:43 -  
[TXT]More Illegal Aliens Accused in Gang Rapes.htm2012-10-01 17:31 3.9K 
[DIR]More Illegal Aliens Accused in Gang Rapes_files/2015-10-04 18:43 -  
[TXT]More Jewish Mobsters Arriving.htm2012-10-01 17:30 7.7K 
[DIR]More Jewish Mobsters Arriving_files/2015-10-04 18:43 -  
[TXT]More Legal Atrocities Against Serbian Whites.htm2012-10-01 17:31 9.5K 
[DIR]More Legal Atrocities Against Serbian Whites_files/2015-10-04 18:43 -  
[   ]Morell.pdf2012-10-01 17:31 1.1M 
[   ]More on Reparations2012-10-01 17:33 19K 
[TXT]More on the Cabbala.htm2012-10-01 17:34 7.9K 
[DIR]More on the Cabbala_files/2015-10-04 18:43 -  
[TXT]More on the Orlando Sentinel's Campaign Against Free Speech and Thought.htm2012-10-01 17:32 7.4K 
[DIR]More on the Orlando Sentinel's Campaign Against Free Speech and Thought_files/2015-10-04 18:43 -  
[   ]MorrisDeesDivorcePapers.pdf2012-10-01 17:31 33K 
[   ]MorrisDeesFactSheet.pdf2012-10-01 17:33 203K 
[   ]MossadKillingMahcine.rtf2012-10-01 17:28 36K 
[TXT]Mothers in Houston Join Katrina Altercation.htm2012-10-01 17:31 3.4K 
[DIR]Mothers in Houston Join Katrina Altercation_files/2015-10-04 18:43 -  
[TXT]MuadDib's Primer on the Jews.htm2012-10-01 17:32 72K 
[DIR]MuadDib's Primer on the Jews_files/2015-10-04 18:43 -  
[TXT]Multicultural Jihad Wrecks Dutch Racial Harmony.htm2012-10-01 17:27 2.1K 
[DIR]Multicultural Jihad Wrecks Dutch Racial Harmony_files/2015-10-04 18:43 -  
[TXT]Multiracial Children Have More Psychological Problems.htm2012-10-01 17:30 4.4K 
[DIR]Multiracial Children Have More Psychological Problems_files/2015-10-04 18:43 -  
[TXT]Multiracialism and Conservatism.htm2012-10-01 17:33 21K 
[DIR]Multiracialism and Conservatism_files/2015-10-04 18:43 -  
[TXT]Museum Pulls 'Offensive' Artwork.htm2012-10-01 17:34 7.3K 
[DIR]Museum Pulls 'Offensive' Artwork_files/2015-10-04 18:43 -  
[TXT]Muslim 'Tolerance' Boils Over in Egypt.htm2012-10-01 17:31 5.4K 
[DIR]Muslim 'Tolerance' Boils Over in Egypt_files/2015-10-04 18:43 -  
[TXT]Muslims Back Down In Face of White 'Threat'.htm2012-10-01 17:32 6.5K 
[DIR]Muslims Back Down In Face of White 'Threat'_files/2015-10-04 18:43 -  
[TXT]My Big Biofuels Bet.htm2012-10-01 17:34 33K 
[DIR]My Big Biofuels Bet_files/2015-10-04 18:43 -  
[   ]MyHonorIsLoyalty.pdf2012-10-01 17:31 1.0M 
[   ]MyLifeOnThePlains.pdf2012-10-01 17:34 732K 
[TXT]Mystery of the mummies.htm2012-10-01 17:30 19K 
[DIR]Mystery of the mummies_files/2015-10-04 18:43 -  
[   ]MythOfDiversity.pdf2012-10-01 17:31 31K 
[TXT]Myths, Misunderstandings, and Outright Lies - gold-confiscation-1933.htm2012-10-01 17:31 35K 
[DIR]Myths, Misunderstandings, and Outright Lies - gold-confiscation-1933_files/2015-10-04 18:43 -  
[TXT]N.O. Cops Suspected of Stealing Up to 200 Cars.htm2012-10-01 17:27 3.8K 
[DIR]N.O. Cops Suspected of Stealing Up to 200 Cars_files/2015-10-04 18:43 -  
[   ]NFS_I.rar2012-10-01 17:32 90M 
[TXT]NJ - Mestizo Cop Helped Drug Ring Say Officials.htm2012-10-01 17:30 4.0K 
[DIR]NJ - Mestizo Cop Helped Drug Ring Say Officials_files/2015-10-04 18:43 -  
[TXT]NJ - New Black Panthers Come to Town.htm2012-10-01 17:27 4.4K 
[DIR]NJ - New Black Panthers Come to Town_files/2015-10-04 18:43 -  
[TXT]NJ Ethics Office - Fagan Stole $400,000.htm2012-10-01 17:33 3.5K 
[DIR]NJ Ethics Office - Fagan Stole $400,000_files/2015-10-04 18:43 -  
[TXT]NJ Governor's Jewish Financial Angel - Also Clinton Backer, 'Holocaust' Appointee.htm2012-10-01 17:28 5.7K 
[TXT]NY Times Hit Hard as Controlled Media Take Continued Beating.htm2012-10-01 17:31 2.3K 
[DIR]NY Times Hit Hard as Controlled Media Take Continued Beating_files/2015-10-04 18:43 -  
[TXT]Namibia, Africa - One Rape Every 60 Minutes.htm2012-10-01 17:30 1.9K 
[TXT]Namibia - Tribe Demands German Reparations.htm2012-10-01 17:33 3.7K 
[DIR]Namibia - Tribe Demands German Reparations_files/2015-10-04 18:43 -  
[   ]Natallnews site.doc2012-10-01 17:31 67K 
[   ]National Alliance Comic - Saga Of White Will.pdf2012-10-01 17:32 17M 
[TXT]National Alliance Speaks at Campus Mideast Forum.htm2012-10-01 17:30 10K 
[DIR]National Alliance Speaks at Campus Mideast Forum_files/2015-10-04 18:43 -  
[TXT]National Vanguard - Just Say No to Illegal Immigrants.htm2012-10-01 17:32 9.2K 
[DIR]National Vanguard - Just Say No to Illegal Immigrants_files/2015-10-04 18:43 -  
[TXT]National Vanguard Activist Wins Victory Against Censorship.htm2012-10-01 17:31 6.3K 
[DIR]National Vanguard Activist Wins Victory Against Censorship_files/2015-10-04 18:43 -  
[   ]National Vanguard Magazine #129 - sample.pdf2012-10-01 17:33 336K 
[   ]NaturesEternalReligionOrig.pdf2012-10-01 17:28 1.1M 
[   ]Nebilung.pdf2012-10-01 17:33 492K 
[   ]Nebilung.rtf2012-10-01 17:31 599K 
[TXT]Negro Accused of Spreading AIDS.htm2012-10-01 17:32 4.0K 
[DIR]Negro Accused of Spreading AIDS_files/2015-10-04 18:43 -  
[TXT]Nerds Join Neo-Cons to Oppose National Vanguard.htm2012-10-01 17:28 4.5K 
[DIR]Nerds Join Neo-Cons to Oppose National Vanguard_files/2015-10-04 18:43 -  
[TXT]Netherlands - Jihadi Plot Upsets Liberals.htm2012-10-01 17:33 3.2K 
[DIR]Netherlands - Jihadi Plot Upsets Liberals_files/2015-10-04 18:43 -  
[TXT]Netherlands Braces for 'Jihad'.htm2012-10-01 17:32 2.1K 
[DIR]Netherlands Braces for 'Jihad'_files/2015-10-04 18:43 -  
[TXT]New Africa.htm2012-10-01 17:33 4.4K 
[DIR]New Africa_files/2015-10-04 18:43 -  
[   ]NewAfricans.pdf2012-10-01 17:33 35K 
[TXT]New Book Helps White Families Become Prosperous.htm2012-10-01 17:30 2.9K 
[DIR]New Book Helps White Families Become Prosperous_files/2015-10-04 18:43 -  
[TXT]New Charges for Lightfingers Tom.htm2012-10-01 17:28 2.9K 
[DIR]New Charges for Lightfingers Tom_files/2015-10-04 18:43 -  
[TXT]New From FEMA - The Looter Relocation Program.htm2012-10-01 17:31 4.6K 
[DIR]New From FEMA - The Looter Relocation Program_files/2015-10-04 18:43 -  
[TXT]New Jersey - Jews Refuse to Vote in Churches.htm2012-10-01 17:31 7.5K 
[DIR]New Jersey - Jews Refuse to Vote in Churches_files/2015-10-04 18:43 -  
[TXT]New Jersey Girl Murdered and Dismembered By Mestizos.htm2012-10-01 17:27 3.1K 
[DIR]New Jersey Girl Murdered and Dismembered By Mestizos_files/2015-10-04 18:43 -  
[TXT]New Jersey Icebergs and Whores.htm2012-10-01 17:32 25K 
[DIR]New Jersey Icebergs and Whores_files/2015-10-04 18:43 -  
[TXT]New Jersey Rabbi Says Katrina Refugees Welcome in Utah.htm2012-10-01 17:32 3.2K 
[DIR]New Jersey Rabbi Says Katrina Refugees Welcome in Utah_files/2015-10-04 18:43 -  
[TXT]New Orleans - Cops Join in Looting.htm2012-10-01 17:29 3.8K 
[DIR]New Orleans - Cops Join in Looting_files/2015-10-04 18:43 -  
[TXT]New Orleans - Second Amendment Suspended.htm2012-10-01 17:32 2.8K 
[DIR]New Orleans - Second Amendment Suspended_files/2015-10-04 18:43 -  
[TXT]New Orleans - The Rise of 'Mighty Whitey'.htm2012-10-01 17:31 3.1K 
[DIR]New Orleans - The Rise of 'Mighty Whitey'_files/2015-10-04 18:43 -  
[TXT]New Orleans Africa-Like Well Before Hurricane Katrina.htm2012-10-01 17:33 5.1K 
[DIR]New Orleans Africa-Like Well Before Hurricane Katrina_files/2015-10-04 18:43 -  
[TXT]New Orleans Chaos Reveals America on the Brink.htm2012-10-01 17:31 3.7K 
[DIR]New Orleans Chaos Reveals America on the Brink_files/2015-10-04 18:43 -  
[TXT]New Orleans Corrupt 'Down to the Bone,' Former Pol Charges.htm2012-10-01 17:31 3.1K 
[DIR]New Orleans Corrupt 'Down to the Bone,' Former Pol Charges_files/2015-10-04 18:43 -  
[TXT]New Orleans Descends into Africa-like Savagery.htm2012-10-01 17:33 12K 
[DIR]New Orleans Descends into Africa-like Savagery_files/2015-10-04 18:43 -  
[TXT]New Orleans Parody Challenges System Media.htm2012-10-01 17:34 3.5K 
[DIR]New Orleans Parody Challenges System Media_files/2015-10-04 18:43 -  
[TXT]New Orleans Pays For Affirmative Action.htm2012-10-01 17:32 3.9K 
[DIR]New Orleans Pays For Affirmative Action_files/2015-10-04 18:43 -  
[TXT]New Orleans and 'The Gods of the Copybook Headings'.htm2012-10-01 17:33 27K 
[DIR]New Orleans and 'The Gods of the Copybook Headings'_files/2015-10-04 18:43 -  
[TXT]New Orleans gun confiscation is foolish and illegal.htm2012-10-01 17:32 7.2K 
[TXT]New Report Sheds Light on Hispanics in U.S..htm2012-10-01 17:29 3.8K 
[DIR]New Report Sheds Light on Hispanics in U.S._files/2015-10-04 18:43 -  
[TXT]New Sex Scandal Rocks Holy See.htm2012-10-01 17:28 5.2K 
[DIR]New Sex Scandal Rocks Holy See_files/2015-10-04 18:43 -  
[TXT]New V-TV Video - Katrina Relief.htm2012-10-01 17:33 2.9K 
[DIR]New V-TV Video - Katrina Relief_files/2015-10-04 18:43 -  
[TXT]New York Times - Chertoff Approved Abu Ghraib Interrogation Methods.htm2012-10-01 17:33 5.1K 
[DIR]New York Times - Chertoff Approved Abu Ghraib Interrogation Methods_files/2015-10-04 18:43 -  
[TXT]New Yorkers to study about Israel.htm2012-10-01 17:28 15K 
[DIR]New Yorkers to study about Israel_files/2015-10-04 18:43 -  
[   ]Newsletter Sign Up.rar2012-10-01 17:33 601K 
[TXT]Newspaper Calls Mass-Murder 'Sad' Flier Distribution 'Despicable'.htm2012-10-01 17:33 4.3K 
[DIR]Newspaper Calls Mass-Murder 'Sad' Flier Distribution 'Despicable'_files/2015-10-04 18:43 -  
[TXT]Newsweek - Superlobbyist is Crooked.htm2012-10-01 17:31 2.8K 
[DIR]Newsweek - Superlobbyist is Crooked_files/2015-10-04 18:43 -  
[TXT]Nick Griffin - The Race Murders the Media Ignore.htm2012-10-01 17:32 2.5K 
[DIR]Nick Griffin - The Race Murders the Media Ignore_files/2015-10-04 18:43 -  
[TXT]No, We're Not 'All Israelis Now'.htm2012-10-01 17:28 8.6K 
[DIR]No, We're Not 'All Israelis Now'_files/2015-10-04 18:43 -  
[TXT]No Black Day in Jesse's Hometown.htm2012-10-01 17:34 4.1K 
[DIR]No Black Day in Jesse's Hometown_files/2015-10-04 18:43 -  
[TXT]No Debit Cards for White People.htm2012-10-01 17:33 2.4K 
[DIR]No Debit Cards for White People_files/2015-10-04 18:43 -  
[TXT]Norman Language Flourishes in the Channel Islands.htm2012-10-01 17:33 5.8K 
[DIR]Norman Language Flourishes in the Channel Islands_files/2015-10-04 18:43 -  
[TXT]North American Students Trained for 'Merger'.htm2012-10-01 17:30 4.1K 
[DIR]North American Students Trained for 'Merger'_files/2015-10-04 18:43 -  
[TXT]Norway - 19,000 'Asylum' Seekers Evade Authorities.htm2012-10-01 17:31 2.0K 
[DIR]Norway - 19,000 'Asylum' Seekers Evade Authorities_files/2015-10-04 18:43 -  
[TXT]Norwegian Patriots Demolish Sell-outs.htm2012-10-01 17:31 3.5K 
[DIR]Norwegian Patriots Demolish Sell-outs_files/2015-10-04 18:43 -  
[TXT]Norwegian Teens Cool to 'Diversity'.htm2012-10-01 17:30 2.8K 
[DIR]Norwegian Teens Cool to 'Diversity'_files/2015-10-04 18:43 -  
[TXT]Norwegians Discover Joys of Islam.htm2012-10-01 17:30 2.7K 
[DIR]Norwegians Discover Joys of Islam_files/2015-10-04 18:43 -  
[   ]Nov01.pdf2012-10-01 17:31 909K 
[   ]Nov02.pdf2012-10-01 17:31 1.8M 
[   ]Nov03.pdf2012-10-01 17:33 871K 
[   ]Nov04.pdf2012-10-01 17:32 634K 
[TXT]Nutty Professor Charged In Hate Crime Hoax.htm2012-10-01 17:30 4.2K 
[DIR]Nutty Professor Charged In Hate Crime Hoax_files/2015-10-04 18:43 -  
[TXT]Oakland - Black-Yemeni Tension Ratcheted Up.htm2012-10-01 17:28 4.5K 
[DIR]Oakland - Black-Yemeni Tension Ratcheted Up_files/2015-10-04 18:43 -  
[TXT]Oakland - Black Muslim Tensions Heightened.htm2012-10-01 17:30 7.5K 
[DIR]Oakland - Black Muslim Tensions Heightened_files/2015-10-04 18:43 -  
[TXT]Oakland - Blacks Loot Burned-Out Shell of Arab Store.htm2012-10-01 17:27 3.3K 
[DIR]Oakland - Blacks Loot Burned-Out Shell of Arab Store_files/2015-10-04 18:43 -  
[TXT]Oakland - Video Beating Victim Comes Forward.htm2012-10-01 17:33 3.3K 
[DIR]Oakland - Video Beating Victim Comes Forward_files/2015-10-04 18:43 -  
[TXT]Oakland Beating Video - Cops Baffled.htm2012-10-01 17:30 4.0K 
[DIR]Oakland Beating Video - Cops Baffled_files/2015-10-04 18:43 -  
[TXT]Oakland Update - Blacks Charged With Hate Crimes.htm2012-10-01 17:28 4.4K 
[DIR]Oakland Update - Blacks Charged With Hate Crimes_files/2015-10-04 18:43 -  
[   ]Oct01.pdf2012-10-01 17:31 905K 
[   ]Oct02.pdf2012-10-01 17:28 1.4M 
[   ]Oct03.pdf2012-10-01 17:28 1.1M 
[   ]Oct04.pdf2012-10-01 17:33 705K 
[TXT]October 7, 1571 - The Deliverance of Europe at Lepanto.htm2012-10-01 17:30 11K 
[DIR]October 7, 1571 - The Deliverance of Europe at Lepanto_files/2015-10-04 18:43 -  
[TXT]Of Course There Is an Israel Lobby.htm2012-10-01 17:33 3.1K 
[DIR]Of Course There Is an Israel Lobby_files/2015-10-04 18:43 -  
[TXT]Ohio - War Protest Turns Violent.htm2012-10-01 17:27 3.3K 
[DIR]Ohio - War Protest Turns Violent_files/2015-10-04 18:43 -  
[TXT]On White Genocide.htm2012-10-01 17:32 12K 
[DIR]On White Genocide_files/2015-10-04 18:43 -  
[TXT]Once We See Black We NEVER Go Back.htm2012-10-01 17:31 6.0K 
[DIR]Once We See Black We NEVER Go Back_files/2015-10-04 18:43 -  
[TXT]One Percent of Population Commits Half of Homicides.htm2012-10-01 17:31 120K 
[DIR]One Percent of Population Commits Half of Homicides_files/2015-10-04 18:43 -  
[   ]OneSheaf.pdf2012-10-01 17:30 549K 
[   ]Optimized Krystal Planet Fall 2005 Catalog v3.pdf2012-10-01 17:33 3.4M 
[   ]OriginsOfChristianity.pdf2012-10-01 17:31 538K 
[TXT]Over 75,000 AIDS Cases in New York City.htm2012-10-01 17:33 2.5K 
[DIR]Over 75,000 AIDS Cases in New York City_files/2015-10-04 18:43 -  
[TXT]PC Desecration of Spanish Holy Site.htm2012-10-01 17:33 3.3K 
[DIR]PC Desecration of Spanish Holy Site_files/2015-10-04 18:43 -  
[   ]PRreal.pdf2012-10-01 17:31 446K 
[   ]PUB637.pdf2012-10-01 17:29 233K 
[   ]Pale Horsemen.pdf2012-10-01 17:27 102K 
[   ]PassingOfGreatRace.pdf2012-10-01 17:33 316K 
[   ]PassingOfTheGreatRace.rtf2012-10-01 17:31 439K 
[TXT]Patric Ewing testifies he twice had oral sex at Gold Club.htm2012-10-01 17:33 29K 
[DIR]Patric Ewing testifies he twice had oral sex at Gold Club_files/2015-10-04 18:43 -  
[   ]Paul Jalsevac - The Inherent Racism Of Population Control.pdf2012-10-01 17:28 381K 
[TXT]Pay No Attention to the Jews Behind the Curtain—the Iron Curtain.htm2012-10-01 17:28 30K 
[DIR]Pay No Attention to the Jews Behind the Curtain—the Iron Curtain_files/2015-10-04 18:43 -  
[   ]Pennies.rtf2012-10-01 17:34 3.7K 
[   ]People Of Africa.pdf2012-10-01 17:33 134K 
[   ]People Of Africa.zip2012-10-01 17:33 29K 
[TXT]Peterloo Massacre.htm2012-10-01 17:32 33K 
[DIR]Peterloo Massacre_files/2015-10-04 18:43 -  
[TXT]Petty Criminal Leaves Sarkozy Red-Faced.htm2012-10-01 17:33 3.0K 
[DIR]Petty Criminal Leaves Sarkozy Red-Faced_files/2015-10-04 18:43 -  
[   ]Piezoelectric Windmill.pdf2012-10-01 17:29 145K 
[   ]Playstation Copying 4 Mac.pdf2012-10-01 17:28 34K 
[TXT]Poignant Photo Strikes Reader.htm2012-10-01 17:29 2.7K 
[DIR]Poignant Photo Strikes Reader_files/2015-10-04 18:43 -  
[   ]PoisonousMushroom.pdf2012-10-01 17:30 1.0M 
[TXT]Poland Abruptly Cancels a Speech By Critic of the Jewish State.htm2012-10-01 17:28 3.2K 
[DIR]Poland Abruptly Cancels a Speech By Critic of the Jewish State_files/2015-10-04 18:43 -  
[TXT]Police - Hurricane Evacuees Kill Woman who Helped Them.htm2012-10-01 17:31 2.6K 
[DIR]Police - Hurricane Evacuees Kill Woman who Helped Them_files/2015-10-04 18:43 -  
[TXT]Police Demand Resignation of Black Commissioner.htm2012-10-01 17:28 2.3K 
[DIR]Police Demand Resignation of Black Commissioner_files/2015-10-04 18:43 -  
[TXT]Police Looting - Racial Realities Exposed in New Orleans.htm2012-10-01 17:28 4.6K 
[DIR]Police Looting - Racial Realities Exposed in New Orleans_files/2015-10-04 18:43 -  
[TXT]Police Ordered to Stop Looters.htm2012-10-01 17:31 4.3K 
[DIR]Police Ordered to Stop Looters_files/2015-10-04 18:43 -  
[TXT]Polish-Americans Celebrate Harvest Festival.htm2012-10-01 17:31 3.0K 
[DIR]Polish-Americans Celebrate Harvest Festival_files/2015-10-04 18:43 -  
[TXT]Polish Father of US Cavalry Laid to Rest.htm2012-10-01 17:30 4.2K 
[DIR]Polish Father of US Cavalry Laid to Rest_files/2015-10-04 18:43 -  
[TXT]Political Correctness - The Scourge of Our Times.htm2012-10-01 17:28 3.9K 
[DIR]Political Correctness - The Scourge of Our Times_files/2015-10-04 18:43 -  
[TXT]Political Prisoners - In America.htm2012-10-01 17:31 8.3K 
[DIR]Political Prisoners - In America_files/2015-10-04 18:43 -  
[TXT]Poll Shows Rising Tide of anti-Semitism on Eve of Holocaust Day.htm2012-10-01 17:31 3.0K 
[DIR]Poll Shows Rising Tide of anti-Semitism on Eve of Holocaust Day_files/2015-10-04 18:43 -  
[TXT]Polls Show Opposition to Iraq War at All-Time High.htm2012-10-01 17:30 3.4K 
[DIR]Polls Show Opposition to Iraq War at All-Time High_files/2015-10-04 18:43 -  
[TXT]Powerful Gains For Pro-Whites in Norwegian Elections.htm2012-10-01 17:31 3.3K 
[DIR]Powerful Gains For Pro-Whites in Norwegian Elections_files/2015-10-04 18:43 -  
[TXT]Pre-Traumatic Stress Disorder-A Glimpse Into Israeli Collective Psychosis.htm2012-10-01 17:34 31K 
[DIR]Pre-Traumatic Stress Disorder-A Glimpse Into Israeli Collective Psychosis_files/2015-10-04 18:43 -  
[TXT]President Putin - 'Orthodox Christianity an Integral Part of Russian Culture'.htm2012-10-01 17:28 2.0K 
[DIR]President Putin - 'Orthodox Christianity an Integral Part of Russian Culture'_files/2015-10-04 18:43 -  
[TXT]Pressure on Chertoff Builds.htm2012-10-01 17:33 3.1K 
[DIR]Pressure on Chertoff Builds_files/2015-10-04 18:43 -  
[TXT]Principal Negative Stereotypes Against European Americans.htm2012-10-01 17:32 7.4K 
[DIR]Principal Negative Stereotypes Against European Americans_files/2015-10-04 18:43 -  
[TXT]Pro-Zionist Televangelist Advocates Murder.htm2012-10-01 17:32 4.4K 
[DIR]Pro-Zionist Televangelist Advocates Murder_files/2015-10-04 18:43 -  
[TXT]Pro and Con - NFL Star Allegedly Runs Over Teens in Stolen Car.htm2012-10-01 17:28 3.3K 
[DIR]Pro and Con - NFL Star Allegedly Runs Over Teens in Stolen Car_files/2015-10-04 18:43 -  
[TXT]Progress Party Gets It Right.htm2012-10-01 17:32 2.7K 
[DIR]Progress Party Gets It Right_files/2015-10-04 18:43 -  
[TXT]Prophecy of the Seeress.htm2012-10-01 17:31 42K 
[DIR]Prophecy of the Seeress_files/2015-10-04 18:43 -  
[TXT]Protestants and Catholics Unite -- For a Brown Ireland.htm2012-10-01 17:32 3.9K 
[DIR]Protestants and Catholics Unite -- For a Brown Ireland_files/2015-10-04 18:43 -  
[TXT]Protests Loom in Far West, Washington.htm2012-10-01 17:31 3.7K 
[DIR]Protests Loom in Far West, Washington_files/2015-10-04 18:43 -  
[   ]ProtocolsOfZion.pdf2012-10-01 17:31 216K 
[TXT]Prussian Blue and the First Amendment.htm2012-10-01 17:29 8.1K 
[DIR]Prussian Blue and the First Amendment_files/2015-10-04 18:43 -  
[   ]PrussianismAndSocialism.pdf2012-10-01 17:34 191K 
[TXT]Purchasing Precious Metals.htm2012-10-01 17:29 106K 
[DIR]Purchasing Precious Metals_files/2015-10-04 18:43 -  
[TXT]Putin's Cannibals 'Gaffe'.htm2012-10-01 17:32 2.5K 
[DIR]Putin's Cannibals 'Gaffe'_files/2015-10-04 18:43 -  
[TXT]Putin, the Patriot.htm2012-10-01 17:29 2.3K 
[DIR]Putin, the Patriot_files/2015-10-04 18:43 -  
[TXT]Putin - Those Who Bombed Serbia Should Pay Damages.htm2012-10-01 17:33 3.0K 
[DIR]Putin - Those Who Bombed Serbia Should Pay Damages_files/2015-10-04 18:43 -  
[TXT]Putin Pilgrimage Strengthens Greco-Russian Links.htm2012-10-01 17:28 3.9K 
[DIR]Putin Pilgrimage Strengthens Greco-Russian Links_files/2015-10-04 18:43 -  
[   ]QueenIsabella.pdf2012-10-01 17:31 875K 
[   ]QueenIsabella.rtf2012-10-01 17:34 351K 
[TXT]Questions That May Not Be Asked About New Orleans.htm2012-10-01 17:34 4.5K 
[DIR]Questions That May Not Be Asked About New Orleans_files/2015-10-04 18:43 -  
[TXT]Questions of Preferential Treatment Raised in Sex Case.htm2012-10-01 17:33 4.2K 
[DIR]Questions of Preferential Treatment Raised in Sex Case_files/2015-10-04 18:43 -  
[   ]QuotesAboutJews.pdf2012-10-01 17:33 1.2M 
[   ]READ-DavidLane's final addr.PDF2012-10-01 17:34 21K 
[   ]README Open Letter- English.PDF2012-10-01 17:32 21K 
[TXT]RESULTS OF MINNESOTA TRANSRACIAL ADOPTION STUDY.htm2012-10-01 17:32 9.9K 
[DIR]RESULTS OF MINNESOTA TRANSRACIAL ADOPTION STUDY_files/2015-10-04 18:43 -  
[   ]RFP_SFP-App.pdf2012-10-01 17:31 679K 
[TXT]Rabbi calls for extermination of all Palestinian males.htm2012-10-01 17:32 5.0K 
[TXT]Rabbis to Israeli Military - Kill More Non-Jews.htm2012-10-01 17:33 6.9K 
[DIR]Rabbis to Israeli Military - Kill More Non-Jews_files/2015-10-04 18:43 -  
[TXT]Race-based Medicine Confirms Genetic Differences.htm2012-10-01 17:30 2.5K 
[DIR]Race-based Medicine Confirms Genetic Differences_files/2015-10-04 18:43 -  
[TXT]Race Baiting as New Orleans Sinks.htm2012-10-01 17:32 6.4K 
[DIR]Race Baiting as New Orleans Sinks_files/2015-10-04 18:43 -  
[   ]RaceBook2.doc2012-10-01 17:31 818K 
[   ]RaceEvolutionBehavior.pdf2012-10-01 17:31 1.2M 
[TXT]Race Hated - What Drives Jews.htm2012-10-01 17:31 8.8K 
[   ]RaceMythsFromLeft.pdf2012-10-01 17:29 40K 
[   ]RaceOfAncientEgypt.pdf2012-10-01 17:31 259K 
[   ]Race_Evolution_Behavior.pdf2012-10-01 17:31 2.7M 
[TXT]Race and Murder.htm2012-10-01 17:34 5.3K 
[DIR]Race and Murder_files/2015-10-04 18:43 -  
[TXT]Race in Ancient Egypt.htm2012-10-01 17:33 2.1K 
[DIR]Race in Ancient Egypt_files/2015-10-04 18:43 -  
[   ]RachelCorrie.pdf2012-10-01 17:31 129K 
[TXT]Racial Battle-Lines Divide School.htm2012-10-01 17:28 3.5K 
[DIR]Racial Battle-Lines Divide School_files/2015-10-04 18:43 -  
[TXT]Racial Explosion 60 Years On.htm2012-10-01 17:29 24K 
[DIR]Racial Explosion 60 Years On_files/2015-10-04 18:43 -  
[TXT]Racial Media Jump on Katrina News.htm2012-10-01 17:28 3.6K 
[DIR]Racial Media Jump on Katrina News_files/2015-10-04 18:43 -  
[   ]RacialOriginOfJews.pdf2012-10-01 17:28 52K 
[TXT]Racial Reality and the New Orleans Nightmare.htm2012-10-01 17:31 3.1K 
[DIR]Racial Reality and the New Orleans Nightmare_files/2015-10-04 18:43 -  
[TXT]Racial Test Gap Remains Large in California.htm2012-10-01 17:33 2.6K 
[DIR]Racial Test Gap Remains Large in California_files/2015-10-04 18:43 -  
[TXT]Racialism versus Communitarianism.htm2012-10-01 17:32 26K 
[DIR]Racialism versus Communitarianism_files/2015-10-04 18:43 -  
[   ]Rad-ad.pdf2012-10-01 17:27 123K 
[TXT]Radical White Intellectual Predicts World-Altering Tempest.htm2012-10-01 17:29 9.8K 
[DIR]Radical White Intellectual Predicts World-Altering Tempest_files/2015-10-04 18:43 -  
[TXT]Radio Station Urges 'Kill Tookie' Emails to Schwarzenegger.htm2012-10-01 17:31 3.1K 
[DIR]Radio Station Urges 'Kill Tookie' Emails to Schwarzenegger_files/2015-10-04 18:43 -  
[TXT]Ramadan Madness Looms.htm2012-10-01 17:28 4.3K 
[DIR]Ramadan Madness Looms_files/2015-10-04 18:43 -  
[TXT]Rap King Shot in Florida.htm2012-10-01 17:31 3.2K 
[DIR]Rap King Shot in Florida_files/2015-10-04 18:43 -  
[   ]Ravage_1.pdf2012-10-01 17:31 446K 
[   ]Ravage_2.pdf2012-10-01 17:28 655K 
[TXT]Reading, Writing and Race.htm2012-10-01 17:28 230K 
[DIR]Reading, Writing and Race_files/2015-10-04 18:43 -  
[TXT]Real Racial Supremacism.htm2012-10-01 17:28 24K 
[DIR]Real Racial Supremacism_files/2015-10-04 18:43 -  
[TXT]Recent Events Show America is Changing.htm2012-10-01 17:32 3.9K 
[DIR]Recent Events Show America is Changing_files/2015-10-04 18:43 -  
[   ]Reflections Dental.rtf2012-10-01 17:31 3.1K 
[TXT]Refugee Numbers On the Rise.htm2012-10-01 17:33 2.1K 
[DIR]Refugee Numbers On the Rise_files/2015-10-04 18:43 -  
[TXT]Religious Group Flagellate Selves Over 'Reparations'.htm2012-10-01 17:28 7.2K 
[DIR]Religious Group Flagellate Selves Over 'Reparations'_files/2015-10-04 18:43 -  
[TXT]Remember the Turkish Genocide of the Pontic Greeks.htm2012-10-01 17:33 6.2K 
[DIR]Remember the Turkish Genocide of the Pontic Greeks_files/2015-10-04 18:43 -  
[   ]Renewable Energy Home Products Brochure.pdf2012-10-01 17:28 936K 
[TXT]Report - Cannibalism in New Orleans.htm2012-10-01 17:32 2.7K 
[DIR]Report - Cannibalism in New Orleans_files/2015-10-04 18:43 -  
[TXT]Report Illegal Aliens - status_report.htm2012-10-01 17:32 40K 
[DIR]Report Illegal Aliens - status_report_files/2015-10-04 18:43 -  
[TXT]Republicans Back Pro-Homosexual 'Hate Crimes' Expansion.htm2012-10-01 17:30 3.4K 
[DIR]Republicans Back Pro-Homosexual 'Hate Crimes' Expansion_files/2015-10-04 18:43 -  
[TXT]Resisting Defamation - Principal Negative Stereotypes Against European Americans.htm2012-10-01 17:31 1.7K 
[DIR]Resisting Defamation - Principal Negative Stereotypes Against European Americans_files/2015-10-04 18:43 -  
[TXT]Resisting Defamatory Anti-White Language.htm2012-10-01 17:31 16K 
[DIR]Resisting Defamatory Anti-White Language_files/2015-10-04 18:43 -  
[   ]Restaurant Owner_ NOT GUILTY for squishing savage Shantavious!.nws2012-10-01 17:33 2.1K 
[TXT]Restoring The Small Farm.htm2012-10-01 17:27 56K 
[DIR]Restoring The Small Farm_files/2015-10-04 18:43 -  
[   ]RethinkingImmigration.pdf2012-10-01 17:34 306K 
[   ]RevisionismConsequences.pdf2012-10-01 17:31 201K 
[   ]RevoltAgainstCivilization.pdf2012-10-01 17:33 489K 
[TXT]Rhode Island - Cops Catch Illegals at Dem Chair's House.htm2012-10-01 17:33 2.9K 
[DIR]Rhode Island - Cops Catch Illegals at Dem Chair's House_files/2015-10-04 18:43 -  
[   ]RightAndWrongRacism.pdf2012-10-01 17:28 43K 
[   ]RisingTideOfColor.pdf2012-10-01 17:29 545K 
[   ]RitualMurderInvestigation.pdf2012-10-01 17:30 4.3M 
[   ]RitualMurderMythOrReality.pdf2012-10-01 17:32 246K 
[TXT]Robert S. Griffin - 2004-09-05 - William Pierce - A Reminiscence.htm2012-10-01 17:34 34K 
[   ]RoboticsUIUC_CropProtectionConf.pdf2012-10-01 17:33 494K 
[TXT]Rockers Demand Recognition of Armenian Genocide.htm2012-10-01 17:30 7.2K 
[DIR]Rockers Demand Recognition of Armenian Genocide_files/2015-10-04 18:43 -  
[   ]Rommel.pdf2012-10-01 17:32 4.8M 
[TXT]Rosa Brooks - Criticize Israel - You're an Anti-Semite.htm2012-10-01 17:28 45K 
[DIR]Rosa Brooks - Criticize Israel - You're an Anti-Semite_files/2015-10-04 18:43 -  
[   ]RosenbergMemoirs.pdf2012-10-01 17:33 705K 
[   ]RulesForLivingWithPeople.pdf2012-10-01 17:29 17K 
[TXT]Rural Traditions of the Pennsylvania Dutch Still Strong.htm2012-10-01 17:32 4.9K 
[DIR]Rural Traditions of the Pennsylvania Dutch Still Strong_files/2015-10-04 18:43 -  
[   ]Rush-un.pdf2012-10-01 17:32 82K 
[TXT]Russia - Jewish Group Worried About Russian Patriots.htm2012-10-01 17:33 3.3K 
[TXT]Russia - Sophisticated Sex Slave Operation Uncovered.htm2012-10-01 17:33 6.1K 
[DIR]Russia - Sophisticated Sex Slave Operation Uncovered_files/2015-10-04 18:43 -  
[TXT]Russia Ponders Tax on Childlessness.htm2012-10-01 17:32 3.1K 
[DIR]Russia Ponders Tax on Childlessness_files/2015-10-04 18:43 -  
[TXT]Russian State Duma Denounces Armenian Genocide.htm2012-10-01 17:28 2.1K 
[DIR]Russian State Duma Denounces Armenian Genocide_files/2015-10-04 18:43 -  
[TXT]Russian Wealth in Hands of Jews - One Hundred Own Quarter of Wealth as Russians Starve.htm2012-10-01 17:31 6.8K 
[DIR]Russian Wealth in Hands of Jews - One Hundred Own Quarter of Wealth as Russians Starve_files/2015-10-04 18:43 -  
[   ]SATGapBW.pdf2012-10-01 17:31 315K 
[   ]SP27.pdf2012-10-01 17:34 159  
[   ]SaddestStory.pdf2012-10-01 17:30 7.2K 
[TXT]San Diego Whites Protest Ethnic Cleansing.htm2012-10-01 17:33 3.2K 
[   ]Sarah_Knox_Taylor_davis.pdf2012-10-01 17:31 24K 
[   ]Savages.pdf2012-10-01 17:34 1.0M 
[TXT]School Officials Look the Other Way When Whites are Abused.htm2012-10-01 17:29 7.5K 
[DIR]School Officials Look the Other Way When Whites are Abused_files/2015-10-04 18:43 -  
[TXT]Science Strikes Back.htm2012-10-01 17:31 87K 
[DIR]Science Strikes Back_files/2015-10-04 18:43 -  
[TXT]Scotland - Poseurs Headed for Kneecapping.htm2012-10-01 17:32 6.0K 
[DIR]Scotland - Poseurs Headed for Kneecapping_files/2015-10-04 18:43 -  
[TXT]Scotland - Race Killing Case Opens.htm2012-10-01 17:33 3.3K 
[DIR]Scotland - Race Killing Case Opens_files/2015-10-04 18:43 -  
[TXT]Seattle Test Scores Anguish.htm2012-10-01 17:28 2.6K 
[DIR]Seattle Test Scores Anguish_files/2015-10-04 18:43 -  
[TXT]Secret Service agents say Cheney was drunk when he shot lawyer.htm2012-10-01 17:33 7.4K 
[   ]SecretsOfFedReserve.pdf2012-10-01 17:28 461K 
[   ]Sep01.pdf2012-10-01 17:28 1.4M 
[   ]Sep02.pdf2012-10-01 17:33 1.6M 
[   ]Sep03.pdf2012-10-01 17:34 676K 
[   ]Sep04.pdf2012-10-01 17:34 559K 
[TXT]Sex Offenders Slip Radar.htm2012-10-01 17:28 2.1K 
[DIR]Sex Offenders Slip Radar_files/2015-10-04 18:43 -  
[TXT]Sex Rabbi - 'I'll Debate David Duke'.htm2012-10-01 17:28 2.8K 
[DIR]Sex Rabbi - 'I'll Debate David Duke'_files/2015-10-04 18:43 -  
[TXT]Sex Trade Flourishing in 'Holy Land'.htm2012-10-01 17:31 2.0K 
[TXT]Sharon - The Al Sharpton of the Middle East.htm2012-10-01 17:31 5.8K 
[DIR]Sharon - The Al Sharpton of the Middle East_files/2015-10-04 18:43 -  
[   ]ShatteringMythOfRacism.pdf2012-10-01 17:28 1.6M 
[   ]Shaun Walker - What Happened to Normal Behavior - 10-08-2005.pdf2012-10-01 17:33 247K 
[TXT]Shmuley loses it.htm2012-10-01 17:30 34K 
[DIR]Shmuley loses it_files/2015-10-04 18:43 -  
[   ]SilentJew.pdf2012-10-01 17:28 35K 
[TXT]Silver - Why You Should Own It.htm2012-10-01 17:31 5.9K 
[DIR]Silver - Why You Should Own It_files/2015-10-04 18:43 -  
[   ]SimpleArithmetic.pdf2012-10-01 17:33 15K 
[TXT]Singapore Bloggers Latest Victims of Multicultural Intolerance.htm2012-10-01 17:31 3.6K 
[DIR]Singapore Bloggers Latest Victims of Multicultural Intolerance_files/2015-10-04 18:43 -  
[TXT]Sinn Fein Touts for Third World Ireland at Westminster.htm2012-10-01 17:31 6.2K 
[DIR]Sinn Fein Touts for Third World Ireland at Westminster_files/2015-10-04 18:43 -  
[TXT]Sir Gawain and the Green Knight - Indo-European Archetypal Myth.htm2012-10-01 17:27 20K 
[DIR]Sir Gawain and the Green Knight - Indo-European Archetypal Myth_files/2015-10-04 18:43 -  
[TXT]Slave Account - Fiction.htm2012-10-01 17:30 3.3K 
[DIR]Slave Account - Fiction_files/2015-10-04 18:43 -  
[   ]SlaveryWhatReallyHappened.pdf2012-10-01 17:31 22K 
[   ]SmartFractionTheory.pdf2012-10-01 17:31 78K 
[TXT]So Long Tookie.htm2012-10-01 17:34 6.0K 
[DIR]So Long Tookie_files/2015-10-04 18:43 -  
[TXT]So You Think You're a White Anti-Racist.htm2012-10-01 17:29 6.1K 
[DIR]So You Think You're a White Anti-Racist_files/2015-10-04 18:43 -  
[TXT]So You Thought the Mob Was Run by Italians.htm2012-10-01 17:28 18K 
[DIR]So You Thought the Mob Was Run by Italians_files/2015-10-04 18:43 -  
[   ]SocialDarwinism.pdf2012-10-01 17:27 16K 
[   ]SocratesVsJesus.pdf2012-10-01 17:34 104K 
[TXT]Some Comments on 'Racism'.htm2012-10-01 17:33 6.3K 
[DIR]Some Comments on 'Racism'_files/2015-10-04 18:43 -  
[TXT]Some Jews Still Attacking Mel Gibson.htm2012-10-01 17:28 5.0K 
[TXT]Soros 'An Extremely Evil Person'.htm2012-10-01 17:27 2.9K 
[DIR]Soros 'An Extremely Evil Person'_files/2015-10-04 18:43 -  
[TXT]Specific Sites Excluded from Google.fr and or Google.de.htm2012-10-01 17:31 58K 
[DIR]Specific Sites Excluded from Google.fr and or Google.de_files/2015-10-04 18:43 -  
[TXT]Spelling Used TV to Push Homosexual Agenda.htm2012-10-01 17:28 5.1K 
[DIR]Spelling Used TV to Push Homosexual Agenda_files/2015-10-04 18:43 -  
[TXT]Spoof - Byzantine Emperor Apologizes to Muslims For Quote.htm2012-10-01 17:31 4.3K 
[DIR]Spoof - Byzantine Emperor Apologizes to Muslims For Quote_files/2015-10-04 18:43 -  
[TXT]St. George and the Harridan.htm2012-10-01 17:33 5.2K 
[DIR]St. George and the Harridan_files/2015-10-04 18:43 -  
[TXT]St. Petersburg, FL - ethnic.htm2012-10-01 17:34 23K 
[DIR]St. Petersburg, FL - ethnic_files/2015-10-04 18:43 -  
[TXT]Stab in the Back - Israel’s Attack on the USS Liberty.htm2012-10-01 17:31 10K 
[DIR]Stab in the Back - Israel’s Attack on the USS Liberty_files/2015-10-04 18:43 -  
[TXT]Stalin’s Willing Executioners - 2005-11-05.txt2012-10-01 17:32 23K 
[TXT]Stalin’s Willing Executioners.txt2012-10-01 17:31 37K 
[TXT]Stanford - Racial Groupings Match Genetic Profiles.htm2012-10-01 17:31 3.1K 
[DIR]Stanford - Racial Groupings Match Genetic Profiles_files/2015-10-04 18:43 -  
[TXT]State Dept. Provides Preview of Life in Aztlan.htm2012-10-01 17:29 24K 
[TXT]Steve E Romer - 2006-04-18 - Make Illegal Aliens Felons - That's Not Enough.htm2012-10-01 17:28 24K 
[DIR]Steve E Romer - 2006-04-18 - Make Illegal Aliens Felons - That's Not Enough_files/2015-10-04 18:43 -  
[TXT]Steven E. Roper - 2003-10-04 - Beyond IQ.txt2012-10-01 17:33 9.3K 
[TXT]Steven E. Roper - 2004-12-11 - White People's Music; White People's Religion.txt2012-10-01 17:31 18K 
[TXT]Steven E Romer - 2006-02-14 - Tiny Differences, Through Time, are Everything.htm2012-10-01 17:28 30K 
[DIR]Steven E Romer - 2006-02-14 - Tiny Differences, Through Time, are Everything_files/2015-10-04 18:43 -  
[TXT]Stop White Genocide.htm2012-10-01 17:31 27K 
[DIR]Stop White Genocide_files/2015-10-04 18:43 -  
[TXT]Stopping the Unstoppable.htm2012-10-01 17:33 24K 
[DIR]Stopping the Unstoppable_files/2015-10-04 18:43 -  
[   ]StrangeLifeOfNikolaTesla.pdf2012-10-01 17:30 284K 
[TXT]Strangers Among Us.htm2012-10-01 17:34 56K 
[DIR]Strangers Among Us_files/2015-10-04 18:43 -  
[TXT]Strong Showing for BNP.htm2012-10-01 17:31 3.1K 
[DIR]Strong Showing for BNP_files/2015-10-04 18:43 -  
[TXT]Subverting the Disney Legacy - Michael Eisner.htm2012-10-01 17:30 16K 
[DIR]Subverting the Disney Legacy - Michael Eisner_files/2015-10-04 18:43 -  
[TXT]Supermob - Sidney Korshak and His Criminal Associates.htm2012-10-01 17:29 5.0K 
[DIR]Supermob - Sidney Korshak and His Criminal Associates_files/2015-10-04 18:43 -  
[TXT]Support Freedom of Speech - Wear the Wristband.htm2012-10-01 17:33 5.0K 
[DIR]Support Freedom of Speech - Wear the Wristband_files/2015-10-04 18:43 -  
[TXT]Surrounded by Jews, Bush Blasts Mahathir, Says He's 'Wrong' About Jewish Power.htm2012-10-01 17:28 3.3K 
[DIR]Surrounded by Jews, Bush Blasts Mahathir, Says He's 'Wrong' About Jewish Power_files/2015-10-04 18:43 -  
[TXT]Survey - Israel is Number One Threat to World Peace.htm2012-10-01 17:31 5.8K 
[DIR]Survey - Israel is Number One Threat to World Peace_files/2015-10-04 18:43 -  
[TXT]Suspect - My Job Is 'Taking White People's Cars'.htm2012-10-01 17:32 12K 
[DIR]Suspect - My Job Is 'Taking White People's Cars'_files/2015-10-04 18:43 -  
[   ]Sustainable_Design_Goals.pdf2012-10-01 17:31 486K 
[TXT]Swedes Arrest Alleged 'Anti-Fascist' Terrorist.htm2012-10-01 17:34 3.8K 
[DIR]Swedes Arrest Alleged 'Anti-Fascist' Terrorist_files/2015-10-04 18:43 -  
[TXT]Swedes Embrace Inquisition.htm2012-10-01 17:27 4.6K 
[DIR]Swedes Embrace Inquisition_files/2015-10-04 18:43 -  
[TXT]Swiss Banks and the Jews - What Happened to the Extra Billion.htm2012-10-01 17:28 12K 
[DIR]Swiss Banks and the Jews - What Happened to the Extra Billion_files/2015-10-04 18:43 -  
[TXT]Synagogue Desecration Shocks London.htm2012-10-01 17:31 7.3K 
[DIR]Synagogue Desecration Shocks London_files/2015-10-04 18:43 -  
[TXT]Syrians Snuff Islamist Attack on US.htm2012-10-01 17:28 4.5K 
[DIR]Syrians Snuff Islamist Attack on US_files/2015-10-04 18:43 -  
[   ]THE 100% SOLUTION.pdf2012-10-01 17:28 86K 
[TXT]THE ARYANS, OR NOBLES.htm2012-10-01 17:34 11K 
[DIR]THE ARYANS, OR NOBLES_files/2015-10-04 18:43 -  
[TXT]THE CHINK IN OUR ARMOR.htm2012-10-01 17:30 20K 
[DIR]THE CHINK IN OUR ARMOR_files/2015-10-04 18:43 -  
[   ]THE HIGH COST OF VENGEANCE.rtf2012-10-01 17:33 906K 
[TXT]THE JEWS AND THE CONCENTRATION CAMPS - A FACTUAL APPRAISAL BY THE RED.htm2012-10-01 17:30 16K 
[DIR]THE JEWS AND THE CONCENTRATION CAMPS - A FACTUAL APPRAISAL BY THE RED_files/2015-10-04 18:43 -  
[   ]TWPL_Final.pdf2012-10-01 17:33 3.0M 
[TXT]Take Me to Your Moron.htm2012-10-01 17:28 4.8K 
[DIR]Take Me to Your Moron_files/2015-10-04 18:43 -  
[   ]TakeYourChoice.pdf2012-10-01 17:31 575K 
[   ]TaliessinThroughLoegres.pdf2012-10-01 17:28 97K 
[TXT]Tampa - When Whites Gather.htm2012-10-01 17:30 7.5K 
[DIR]Tampa - When Whites Gather_files/2015-10-04 18:43 -  
[TXT]Tampa Summer Solstice Festival.htm2012-10-01 17:34 2.6K 
[DIR]Tampa Summer Solstice Festival_files/2015-10-04 18:43 -  
[   ]Targetmaster.pdf2012-10-01 17:32 28K 
[   ]TaxonomicConstruct.pdf2012-10-01 17:33 341K 
[TXT]Television Pioneer Elma Farnsworth Dies at 98.htm2012-10-01 17:31 9.5K 
[DIR]Television Pioneer Elma Farnsworth Dies at 98_files/2015-10-04 18:43 -  
[   ]TerrorFree.pdf2012-10-01 17:31 505K 
[TXT]Texas Papers Play Up 'Racial' Quotes by Candidate Friedman.htm2012-10-01 17:30 2.8K 
[DIR]Texas Papers Play Up 'Racial' Quotes by Candidate Friedman_files/2015-10-04 18:43 -  
[   ]TextbookOfTheUniverse.pdf2012-10-01 17:33 12M 
[TXT]That Which is Good, Shall be Called Evil.htm2012-10-01 17:33 9.3K 
[DIR]That Which is Good, Shall be Called Evil_files/2015-10-04 18:43 -  
[TXT]The 'Holocaust' Is A Typical Zionist Myth.htm2012-10-01 17:28 49K 
[DIR]The 'Holocaust' Is A Typical Zionist Myth_files/2015-10-04 18:43 -  
[TXT]The ADL, Jesus, and Anti-Semitism.htm2012-10-01 17:33 4.3K 
[DIR]The ADL, Jesus, and Anti-Semitism_files/2015-10-04 18:43 -  
[TXT]The American Nation.htm2012-10-01 17:31 19K 
[TXT]The American Nation Part II.htm2012-10-01 17:34 17K 
[DIR]The American Nation Part II_files/2015-10-04 18:43 -  
[DIR]The American Nation_files/2015-10-04 18:43 -  
[TXT]The Anthrax Murders - The Israeli Connection, part 1.htm2012-10-01 17:31 25K 
[DIR]The Anthrax Murders - The Israeli Connection, part 1_files/2015-10-04 18:43 -  
[TXT]The Anthrax Murders - The Israeli Connection, part 2.htm2012-10-01 17:32 24K 
[DIR]The Anthrax Murders - The Israeli Connection, part 2_files/2015-10-04 18:43 -  
[TXT]The Anti-White Gangsters of Ulster.htm2012-10-01 17:28 4.4K 
[   ]TheAntichrist.pdf2012-10-01 17:32 164K 
[TXT]The BBC's One Way Racism.htm2012-10-01 17:33 3.3K 
[DIR]The BBC's One Way Racism_files/2015-10-04 18:43 -  
[TXT]The Barack Obama Myth.htm2012-10-01 17:28 7.5K 
[DIR]The Barack Obama Myth_files/2015-10-04 18:43 -  
[TXT]The Beast as Saint - The Truth About 'Martin Luther King'.htm2012-10-01 17:33 23K 
[DIR]The Beast as Saint - The Truth About 'Martin Luther King'_files/2015-10-04 18:43 -  
[TXT]The Biological Puzzle of Jewish Behavior.htm2012-10-01 17:30 12K 
[DIR]The Biological Puzzle of Jewish Behavior_files/2015-10-04 18:43 -  
[TXT]The Broken Wall - newspaper coverage of its advertisers.txt2012-10-01 17:29 24K 
[TXT]The Changing Face of AIDS.htm2012-10-01 17:32 18K 
[DIR]The Changing Face of AIDS_files/2015-10-04 18:43 -  
[TXT]The Christ-Killers Today.htm2012-10-01 17:32 22K 
[DIR]The Christ-Killers Today_files/2015-10-04 18:43 -  
[TXT]The Color Of Crime And The New Orleans Nightmare.htm2012-10-01 17:27 13K 
[DIR]The Color Of Crime And The New Orleans Nightmare_files/2015-10-04 18:43 -  
[   ]TheComingBattle.pdf2012-10-01 17:30 728K 
[TXT]The Confederate Defeat, The Fall Of New Orleans.htm2012-10-01 17:31 44K 
[DIR]The Confederate Defeat, The Fall Of New Orleans_files/2015-10-04 18:43 -  
[TXT]The Congo's Atrocious Secret.htm2012-10-01 17:34 2.1K 
[DIR]The Congo's Atrocious Secret_files/2015-10-04 18:43 -  
[TXT]The Dark Side of the Anti-Defamation League, part 1.htm2012-10-01 17:31 4.3K 
[DIR]The Dark Side of the Anti-Defamation League, part 1_files/2015-10-04 18:43 -  
[TXT]The Dark Side of the Anti-Defamation League, part 2.htm2012-10-01 17:30 3.2K 
[DIR]The Dark Side of the Anti-Defamation League, part 2_files/2015-10-04 18:43 -  
[TXT]The Dark Side of the Anti-Defamation League, part 3.htm2012-10-01 17:33 3.2K 
[DIR]The Dark Side of the Anti-Defamation League, part 3_files/2015-10-04 18:43 -  
[TXT]The Dark Side of the Anti-Defamation League, part 4.htm2012-10-01 17:33 3.3K 
[DIR]The Dark Side of the Anti-Defamation League, part 4_files/2015-10-04 18:43 -  
[TXT]The Dark Side of the Anti-Defamation League, part 5.htm2012-10-01 17:28 3.9K 
[DIR]The Dark Side of the Anti-Defamation League, part 5_files/2015-10-04 18:43 -  
[TXT]The Dark Side of the Anti-Defamation League, part 6.htm2012-10-01 17:33 3.7K 
[DIR]The Dark Side of the Anti-Defamation League, part 6_files/2015-10-04 18:43 -  
[TXT]The Dark Side of the Anti-Defamation League, part 7.htm2012-10-01 17:31 4.2K 
[DIR]The Dark Side of the Anti-Defamation League, part 7_files/2015-10-04 18:43 -  
[TXT]The Dark Side of the Anti-Defamation League, part 8.htm2012-10-01 17:34 3.9K 
[DIR]The Dark Side of the Anti-Defamation League, part 8_files/2015-10-04 18:43 -  
[TXT]The Darkening Face of AIDS.htm2012-10-01 17:34 1.7K 
[TXT]The De-Zionization of the American Mind.htm2012-10-01 17:30 3.7K 
[DIR]The De-Zionization of the American Mind_files/2015-10-04 18:43 -  
[TXT]The Deadly Twins.htm2012-10-01 17:33 11K 
[DIR]The Deadly Twins_files/2015-10-04 18:43 -  
[TXT]The Destruction of White Youth.htm2012-10-01 17:33 3.0K 
[DIR]The Destruction of White Youth_files/2015-10-04 18:43 -  
[TXT]The Dog Gone Asians.htm2012-10-01 17:31 4.6K 
[DIR]The Dog Gone Asians_files/2015-10-04 18:43 -  
[TXT]The Drunken Truth.htm2012-10-01 17:30 18K 
[DIR]The Drunken Truth_files/2015-10-04 18:43 -  
[TXT]The Dutch Say 'Nee!'.htm2012-10-01 17:28 4.8K 
[DIR]The Dutch Say 'Nee!'_files/2015-10-04 18:43 -  
[TXT]The EU Constitution.htm2012-10-01 17:27 6.0K 
[TXT]The Eternal Value of Privacy.htm2012-10-01 17:30 25K 
[DIR]The Eternal Value of Privacy_files/2015-10-04 18:43 -  
[TXT]The Evidence of the Prussian Blue.htm2012-10-01 17:31 14K 
[TXT]The FCC Scandal.htm2012-10-01 17:27 3.8K 
[DIR]The FCC Scandal_files/2015-10-04 18:43 -  
[TXT]The Factory Farms of Jewish Publishing.htm2012-10-01 17:30 15K 
[DIR]The Factory Farms of Jewish Publishing_files/2015-10-04 18:43 -  
[TXT]The Forbidden Srebrenica Report - Something The Neo-cons Don't Want You To See.htm2012-10-01 17:32 3.9K 
[DIR]The Forbidden Srebrenica Report - Something The Neo-cons Don't Want You To See_files/2015-10-04 18:43 -  
[TXT]The Fraud of Neoconservative 'Anti-Communism'.htm2012-10-01 17:32 19K 
[DIR]The Fraud of Neoconservative 'Anti-Communism'_files/2015-10-04 18:43 -  
[TXT]The Gateway.htm2012-10-01 17:31 20K 
[DIR]The Gateway_files/2015-10-04 18:43 -  
[TXT]The Governors Declare An Emergency - Who Cares If They’re Sincere.htm2012-10-01 17:29 3.2K 
[DIR]The Governors Declare An Emergency - Who Cares If They’re Sincere_files/2015-10-04 18:43 -  
[TXT]The Hard Edge of Hatred.htm2012-10-01 17:32 11K 
[DIR]The Hard Edge of Hatred_files/2015-10-04 18:43 -  
[TXT]The Hidden History of 9-11-2001.htm2012-10-01 17:28 130K 
[DIR]The Hidden History of 9-11-2001_files/2015-10-04 18:43 -  
[TXT]The Hidden Tyranny.txt2012-10-01 17:28 50K 
[TXT]The Hollywood Big Lie.htm2012-10-01 17:28 5.9K 
[DIR]The Hollywood Big Lie_files/2015-10-04 18:43 -  
[TXT]The Holocaust Controversy - The Case For Open Debate.htm2012-10-01 17:33 21K 
[DIR]The Holocaust Controversy - The Case For Open Debate_files/2015-10-04 18:43 -  
[TXT]The Holy Man and the Ho.htm2012-10-01 17:27 4.8K 
[DIR]The Holy Man and the Ho_files/2015-10-04 18:43 -  
[   ]TheInternationalJew.pdf2012-10-01 17:30 2.4M 
[   ]TheJewAsCriminal.pdf2012-10-01 17:31 512K 
[TXT]The Jew Who Fled Rio.htm2012-10-01 17:34 19K 
[DIR]The Jew Who Fled Rio_files/2015-10-04 18:43 -  
[TXT]The Jewish Declaration of War.htm2012-10-01 17:31 33K 
[DIR]The Jewish Declaration of War_files/2015-10-04 18:43 -  
[TXT]The Judas Goats.htm2012-10-01 17:31 32K 
[DIR]The Judas Goats_files/2015-10-04 18:43 -  
[   ]TheJungle.pdf2012-10-01 17:32 816K 
[TXT]The Kwanzaa Hoax.htm2012-10-01 17:32 13K 
[DIR]The Kwanzaa Hoax_files/2015-10-04 18:43 -  
[TXT]The Last Straw - Jewish Death Squads in America.htm2012-10-01 17:31 18K 
[DIR]The Last Straw - Jewish Death Squads in America_files/2015-10-04 18:43 -  
[TXT]The Leo Frank case.htm2012-10-01 17:31 57K 
[DIR]The Leo Frank case_files/2015-10-04 18:43 -  
[TXT]The Liberty Tree.htm2012-10-01 17:31 6.0K 
[DIR]The Liberty Tree_files/2015-10-04 18:43 -  
[TXT]The Love of Ages.htm2012-10-01 17:31 22K 
[DIR]The Love of Ages_files/2015-10-04 18:43 -  
[TXT]The Meaning of the Candy Cane.txt2012-10-01 17:31 468  
[TXT]The Middle East Initiative.htm2012-10-01 17:29 18K 
[DIR]The Middle East Initiative_files/2015-10-04 18:43 -  
[TXT]The Missiles at Ground Zero.htm2012-10-01 17:31 21K 
[DIR]The Missiles at Ground Zero_files/2015-10-04 18:43 -  
[TXT]The Most Corrupt Member of Congress.htm2012-10-01 17:31 2.3K 
[DIR]The Most Corrupt Member of Congress_files/2015-10-04 18:43 -  
[TXT]The Neo-Genocidists.htm2012-10-01 17:34 15K 
[DIR]The Neo-Genocidists_files/2015-10-04 18:43 -  
[TXT]The New Minority.htm2012-10-01 17:28 4.9K 
[DIR]The New Minority_files/2015-10-04 18:43 -  
[TXT]The Next Victims of Islamic Terror.htm2012-10-01 17:28 2.9K 
[DIR]The Next Victims of Islamic Terror_files/2015-10-04 18:43 -  
[TXT]The Officially Sanctioned Invasion of Greece.htm2012-10-01 17:34 22K 
[DIR]The Officially Sanctioned Invasion of Greece_files/2015-10-04 18:43 -  
[TXT]The Origins Of 'Racism' - The Curious Beginnings Of A Useless Word.htm2012-10-01 17:32 53K 
[TXT]The Origins of the White Man - Part I.htm2012-10-01 17:31 83K 
[TXT]The Origins of the White Man - Part II.htm2012-10-01 17:34 85K 
[DIR]The Origins of the White Man - Part II_files/2015-10-04 18:43 -  
[DIR]The Origins of the White Man - Part I_files/2015-10-04 18:43 -  
[TXT]The Origins of the Word 'Racism'.htm2012-10-01 17:33 19K 
[DIR]The Origins of the Word 'Racism'_files/2015-10-04 18:43 -  
[   ]ThePhotographersRight.pdf2012-10-01 17:27 54K 
[TXT]The Pope Must Die.htm2012-10-01 17:32 3.9K 
[DIR]The Pope Must Die_files/2015-10-04 18:43 -  
[TXT]The Price White Americans Pay - Never Forget the Hmong Massacre.htm2012-10-01 17:33 13K 
[   ]The Price White Americans Pay - Never Forget the Hmong Massacre.pdf2012-10-01 17:34 320K 
[DIR]The Price White Americans Pay - Never Forget the Hmong Massacre_files/2015-10-04 18:43 -  
[TXT]The Racial Ideology of Empire.htm2012-10-01 17:31 122K 
[DIR]The Racial Ideology of Empire_files/2015-10-04 18:43 -  
[TXT]The Rednecks Did It!.htm2012-10-01 17:32 3.6K 
[DIR]The Rednecks Did It!_files/2015-10-04 18:43 -  
[   ]The Resurrector.pdf2012-10-01 17:31 136K 
[TXT]The Rise of the BNP.htm2012-10-01 17:34 3.9K 
[DIR]The Rise of the BNP_files/2015-10-04 18:43 -  
[TXT]The Self-Evident Lessons of Madrid.htm2012-10-01 17:31 8.3K 
[DIR]The Self-Evident Lessons of Madrid_files/2015-10-04 18:43 -  
[TXT]The Shame of Being an American.htm2012-10-01 17:28 20K 
[DIR]The Shame of Being an American_files/2015-10-04 18:43 -  
[TXT]The Shocking Story of Approved Killing in Mississippi.htm2012-10-01 17:29 38K 
[DIR]The Shocking Story of Approved Killing in Mississippi_files/2015-10-04 18:43 -  
[TXT]The Struggle for Caucasia.htm2012-10-01 17:33 16K 
[DIR]The Struggle for Caucasia_files/2015-10-04 18:43 -  
[TXT]The Symbiants.htm2012-10-01 17:27 8.3K 
[DIR]The Symbiants_files/2015-10-04 18:43 -  
[TXT]The Tapes the Hague Tribunal Hasn't Shown - Muslim Terrorists Massacring Serbs.htm2012-10-01 17:31 2.7K 
[DIR]The Tapes the Hague Tribunal Hasn't Shown - Muslim Terrorists Massacring Serbs_files/2015-10-04 18:43 -  
[TXT]The Truth About Slavery.htm2012-10-01 17:34 23K 
[DIR]The Truth About Slavery_files/2015-10-04 18:43 -  
[TXT]The Truth About Tuskegee.htm2012-10-01 17:29 29K 
[TXT]The United Israeli Emirates of North America.htm2012-10-01 17:32 5.8K 
[TXT]The United States of Barbarism.htm2012-10-01 17:34 3.9K 
[DIR]The United States of Barbarism_files/2015-10-04 18:43 -  
[   ]TheWatchdogs.pdf2012-10-01 17:28 808K 
[   ]TheWayForward.pdf2012-10-01 17:32 579K 
[TXT]The Weird Wild World of the Zionist Right.htm2012-10-01 17:30 5.8K 
[DIR]The Weird Wild World of the Zionist Right_files/2015-10-04 18:43 -  
[TXT]The Weird World of Kwanzaa and Other African Hoaxes.htm2012-10-01 17:33 9.3K 
[DIR]The Weird World of Kwanzaa and Other African Hoaxes_files/2015-10-04 18:43 -  
[TXT]The Whitewashing of Ariel Sharon.htm2012-10-01 17:33 3.6K 
[DIR]The Whitewashing of Ariel Sharon_files/2015-10-04 18:43 -  
[TXT]The Winds of Change.htm2012-10-01 17:28 29K 
[DIR]The Winds of Change_files/2015-10-04 18:43 -  
[TXT]The World is His China Shop and His Shills Make Excuses.htm2012-10-01 17:27 9.7K 
[DIR]The World is His China Shop and His Shills Make Excuses_files/2015-10-04 18:43 -  
[TXT]The Wrath of Ka.htm2012-10-01 17:34 5.8K 
[DIR]The Wrath of Ka_files/2015-10-04 18:43 -  
[TXT]The Zambotistas and the Moslemoids versus the Neo-Cons.htm2012-10-01 17:34 3.6K 
[TXT]The_Jews_in_England_part2.html2012-10-01 17:28 38K 
[DIR]The_Jews_in_England_part2_files/2015-10-04 18:43 -  
[TXT]There is No Freedom Without Free Speech.htm2012-10-01 17:31 14K 
[DIR]There is No Freedom Without Free Speech_files/2015-10-04 18:43 -  
[TXT]There is No Ghetto Pass.htm2012-10-01 17:31 3.6K 
[TXT]There is no place for such a regime in the family of nations.txt2012-10-01 17:30 4.1K 
[TXT]They Want Our Kids.htm2012-10-01 17:33 2.2K 
[DIR]They Want Our Kids_files/2015-10-04 18:43 -  
[   ]ThinkingAboutNeocons.pdf2012-10-01 17:30 147K 
[   ]ThisTimeTheWorld.pdf2012-10-01 17:33 594K 
[   ]ThisTimeTheWorld.rtf2012-10-01 17:27 1.1M 
[TXT]This Will Come Back to Haunt Us.htm2012-10-01 17:31 9.6K 
[DIR]This Will Come Back to Haunt Us_files/2015-10-04 18:43 -  
[TXT]Thomas Carlyle and Edward Bulwer-Lytton - Giants of the North.htm2012-10-01 17:27 51K 
[DIR]Thomas Carlyle and Edward Bulwer-Lytton - Giants of the North_files/2015-10-04 18:43 -  
[TXT]Thomas Jefferson - Letter to the Secretary of the Treasury Albert Gallatin.txt2012-10-01 17:33 756  
[   ]Thomas W. Chittum - Civil War II.pdf2012-10-01 17:28 2.3M 
[TXT]Thousands Protest Violence in Darfur.htm2012-10-01 17:33 3.4K 
[DIR]Thousands Protest Violence in Darfur_files/2015-10-04 18:43 -  
[TXT]Threats to a Free Internet.htm2012-10-01 17:27 17K 
[DIR]Threats to a Free Internet_files/2015-10-04 18:43 -  
[TXT]ThunderDome.htm2012-10-01 17:33 3.5K 
[DIR]ThunderDome_files/2015-10-04 18:43 -  
[   ]ThusSpakeZarathustra.pdf2012-10-01 17:33 917K 
[TXT]Tiny Differences, Through Time, are Everything.htm2012-10-01 17:31 30K 
[DIR]Tiny Differences, Through Time, are Everything_files/2015-10-04 18:43 -  
[TXT]Today Show - Let 'Em Eat Cake.htm2012-10-01 17:33 2.7K 
[DIR]Today Show - Let 'Em Eat Cake_files/2015-10-04 18:43 -  
[   ]Tolerance.pdf2012-10-01 17:33 177K 
[   ]Tolerance.zip2012-10-01 17:31 77K 
[   ]Tom Quick (1851) JR.pdf2012-10-01 17:28 459K 
[TXT]Toni Morrison - She Simply Can't Write.htm2012-10-01 17:33 4.6K 
[DIR]Toni Morrison - She Simply Can't Write_files/2015-10-04 18:43 -  
[TXT]Tonight - Current Issues TV to Host Dr. David Duke.htm2012-10-01 17:34 3.6K 
[DIR]Tonight - Current Issues TV to Host Dr. David Duke_files/2015-10-04 18:43 -  
[TXT]Too White, Too Strong.htm2012-10-01 17:28 9.2K 
[DIR]Too White, Too Strong_files/2015-10-04 18:43 -  
[TXT]Tookie's 'Peaceful' Pals Threaten Violence.htm2012-10-01 17:30 3.0K 
[DIR]Tookie's 'Peaceful' Pals Threaten Violence_files/2015-10-04 18:43 -  
[TXT]Tookie Advocate - 'That’s a racist question!'.htm2012-10-01 17:31 3.4K 
[DIR]Tookie Advocate - 'That’s a racist question!'_files/2015-10-04 18:43 -  
[TXT]Tookie Finally Ready to Snitch.htm2012-10-01 17:34 4.3K 
[DIR]Tookie Finally Ready to Snitch_files/2015-10-04 18:43 -  
[TXT]Top Rabbi - Katrina is God's Punishment for Not Supporting Israel.htm2012-10-01 17:29 2.7K 
[DIR]Top Rabbi - Katrina is God's Punishment for Not Supporting Israel_files/2015-10-04 18:43 -  
[   ]Toronto Rampage Flyer.pdf2012-10-01 17:29 51K 
[TXT]Tourists Evacuated from Superdome.htm2012-10-01 17:30 3.0K 
[DIR]Tourists Evacuated from Superdome_files/2015-10-04 18:43 -  
[TXT]Tourists Targeted in New Orleans as Unrest Spreads to Baton Rouge.htm2012-10-01 17:33 4.2K 
[DIR]Tourists Targeted in New Orleans as Unrest Spreads to Baton Rouge_files/2015-10-04 18:43 -  
[TXT]Troops Back From Iraq Find Another War Zone.htm2012-10-01 17:28 14K 
[DIR]Troops Back From Iraq Find Another War Zone_files/2015-10-04 18:43 -  
[TXT]Troops Find Grisly Scenes in New Orleans Convention Center.htm2012-10-01 17:33 4.9K 
[DIR]Troops Find Grisly Scenes in New Orleans Convention Center_files/2015-10-04 18:43 -  
[TXT]Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast.htm2012-10-01 17:31 145K 
[TXT]Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast2.htm2012-10-01 17:27 143K 
[DIR]Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast2_files/2015-10-04 18:43 -  
[DIR]Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast_files/2015-10-04 18:43 -  
[TXT]Turkey, EU Reach Deal for Opening Talks.htm2012-10-01 17:29 3.7K 
[DIR]Turkey, EU Reach Deal for Opening Talks_files/2015-10-04 18:43 -  
[TXT]Turkey Has No Friends; Good for Europe.htm2012-10-01 17:30 5.4K 
[DIR]Turkey Has No Friends; Good for Europe_files/2015-10-04 18:43 -  
[TXT]Turkey Wins Censorship of Armenian Genocide in German Schools.htm2012-10-01 17:33 3.9K 
[TXT]Turkish Novelist Faces Jail for ‘Hate Speech’.htm2012-10-01 17:33 4.9K 
[DIR]Turkish Novelist Faces Jail for ‘Hate Speech’_files/2015-10-04 18:43 -  
[TXT]Turks Award Zionists with Weapons Contract.htm2012-10-01 17:34 2.3K 
[DIR]Turks Award Zionists with Weapons Contract_files/2015-10-04 18:43 -  
[TXT]Turks Convict Armenian Journalist of 'Speech Crime'.htm2012-10-01 17:30 3.9K 
[DIR]Turks Convict Armenian Journalist of 'Speech Crime'_files/2015-10-04 18:43 -  
[TXT]Turks May Save Drowning Rat.htm2012-10-01 17:28 3.5K 
[DIR]Turks May Save Drowning Rat_files/2015-10-04 18:43 -  
[   ]TurnerDiaries.pdf2012-10-01 17:32 810K 
[   ]TurnerDiaries.rtf2012-10-01 17:31 1.9M 
[TXT]Two More 'Sexual Indoctrination' Bills Vetoed.htm2012-10-01 17:27 3.0K 
[DIR]Two More 'Sexual Indoctrination' Bills Vetoed_files/2015-10-04 18:43 -  
[TXT]U.S. Population Nears 300 Million.htm2012-10-01 17:31 5.4K 
[DIR]U.S. Population Nears 300 Million_files/2015-10-04 18:43 -  
[TXT]U.S.S. Liberty,.html2012-10-01 17:33 57K 
[TXT]U.S.S. Liberty Crew Reunites.htm2012-10-01 17:33 3.8K 
[DIR]U.S.S. Liberty Crew Reunites_files/2015-10-04 18:43 -  
[TXT]U.S. State Department - Israel Plagued by Trafficking.htm2012-10-01 17:31 3.3K 
[DIR]U.S. State Department - Israel Plagued by Trafficking_files/2015-10-04 18:43 -  
[TXT]UK - Al Qaeda 'Cleric' Worked for Both Sides.htm2012-10-01 17:32 4.4K 
[DIR]UK - Al Qaeda 'Cleric' Worked for Both Sides_files/2015-10-04 18:43 -  
[TXT]UK - BNP Music Label Launched.htm2012-10-01 17:28 4.2K 
[DIR]UK - BNP Music Label Launched_files/2015-10-04 18:43 -  
[TXT]UK - BNP Picking Up Votes - Viewed as Persecuted Underdog.htm2012-10-01 17:32 5.0K 
[DIR]UK - BNP Picking Up Votes - Viewed as Persecuted Underdog_files/2015-10-04 18:43 -  
[TXT]UK - Birmingham Riots Result of Multicultural Experiment.htm2012-10-01 17:32 3.3K 
[DIR]UK - Birmingham Riots Result of Multicultural Experiment_files/2015-10-04 18:43 -  
[TXT]UK - Black Gets Prison for al-Qaeda Plot.htm2012-10-01 17:33 2.8K 
[DIR]UK - Black Gets Prison for al-Qaeda Plot_files/2015-10-04 18:43 -  
[TXT]UK - British National Party Chairman Nick Griffin Released.htm2012-10-01 17:29 7.1K 
[DIR]UK - British National Party Chairman Nick Griffin Released_files/2015-10-04 18:43 -  
[TXT]UK - Censorship by Multiracialists Raises Ugly Head.htm2012-10-01 17:32 4.6K 
[DIR]UK - Censorship by Multiracialists Raises Ugly Head_files/2015-10-04 18:43 -  
[TXT]UK - Conservatives Fear Nationalist Competition.htm2012-10-01 17:31 7.5K 
[DIR]UK - Conservatives Fear Nationalist Competition_files/2015-10-04 18:43 -  
[TXT]UK - English Town Continues to Suffer From Multiracialism.htm2012-10-01 17:31 3.1K 
[DIR]UK - English Town Continues to Suffer From Multiracialism_files/2015-10-04 18:43 -  
[TXT]UK - Jews Condemned for Throat-Cutting Ritual.htm2012-10-01 17:31 1.7K 
[TXT]UK - Keighley Protest Still On.htm2012-10-01 17:29 3.9K 
[DIR]UK - Keighley Protest Still On_files/2015-10-04 18:43 -  
[TXT]UK - Muslims Scream About Ice Cream.htm2012-10-01 17:31 4.7K 
[DIR]UK - Muslims Scream About Ice Cream_files/2015-10-04 18:43 -  
[TXT]UK - National Demonstration Against Police Anti-White Racism Planned.htm2012-10-01 17:28 7.6K 
[DIR]UK - National Demonstration Against Police Anti-White Racism Planned_files/2015-10-04 18:43 -  
[TXT]UK - Nov. 2 Free Speech Demo Plan Forges Ahead.htm2012-10-01 17:28 4.1K 
[DIR]UK - Nov. 2 Free Speech Demo Plan Forges Ahead_files/2015-10-04 18:43 -  
[TXT]UK - Now It's Griffin.htm2012-10-01 17:31 12K 
[DIR]UK - Now It's Griffin_files/2015-10-04 18:43 -  
[TXT]UK - Police Arrest Anti-White Goon.htm2012-10-01 17:33 4.0K 
[DIR]UK - Police Arrest Anti-White Goon_files/2015-10-04 18:43 -  
[TXT]UK - Police Investigating Multiracialist Entertainer for Threatening Whites.htm2012-10-01 17:27 3.2K 
[DIR]UK - Police Investigating Multiracialist Entertainer for Threatening Whites_files/2015-10-04 18:43 -  
[TXT]UK - Popular Muslim Video Supports Violence Against Non-Believers.htm2012-10-01 17:33 4.3K 
[DIR]UK - Popular Muslim Video Supports Violence Against Non-Believers_files/2015-10-04 18:43 -  
[TXT]UK - Race Rioting Erupts in Birmingham.htm2012-10-01 17:31 14K 
[DIR]UK - Race Rioting Erupts in Birmingham_files/2015-10-04 18:43 -  
[TXT]UK - Racial Justice Sunday Staged by Rapidly Shrinking Church.htm2012-10-01 17:31 7.8K 
[DIR]UK - Racial Justice Sunday Staged by Rapidly Shrinking Church_files/2015-10-04 18:43 -  
[TXT]UK - Secret Police Seize Nationalist Paper.htm2012-10-01 17:30 11K 
[DIR]UK - Secret Police Seize Nationalist Paper_files/2015-10-04 18:43 -  
[TXT]UK - Top Cop Urges Police To Wear Islamic Battle Colors.htm2012-10-01 17:30 7.2K 
[DIR]UK - Top Cop Urges Police To Wear Islamic Battle Colors_files/2015-10-04 18:43 -  
[TXT]UK - White Leaders Undaunted by Coordinated Violent Attacks.htm2012-10-01 17:30 4.0K 
[DIR]UK - White Leaders Undaunted by Coordinated Violent Attacks_files/2015-10-04 18:43 -  
[TXT]UK - Whites Furious Over Removal of Memorial To Slain Teenager.htm2012-10-01 17:28 3.4K 
[DIR]UK - Whites Furious Over Removal of Memorial To Slain Teenager_files/2015-10-04 18:43 -  
[TXT]UK - Whites Quitting Cities.htm2012-10-01 17:33 3.5K 
[DIR]UK - Whites Quitting Cities_files/2015-10-04 18:43 -  
[TXT]UK = Church Anger at Islamic Texts.htm2012-10-01 17:33 4.4K 
[DIR]UK = Church Anger at Islamic Texts_files/2015-10-04 18:43 -  
[TXT]UK Cops Threaten Vet Over Flag.htm2012-10-01 17:31 9.7K 
[DIR]UK Cops Threaten Vet Over Flag_files/2015-10-04 18:43 -  
[TXT]UK journalist arrested in Israel.htm2012-10-01 17:33 5.1K 
[DIR]UK journalist arrested in Israel_files/2015-10-04 18:43 -  
[   ]UMBCTeenDrivingStudy.pdf2012-10-01 17:33 474K 
[TXT]UN Antislavery Day Celebrates Massacre of Whites.htm2012-10-01 17:27 3.0K 
[DIR]UN Antislavery Day Celebrates Massacre of Whites_files/2015-10-04 18:43 -  
[TXT]US - White Poverty Soars.htm2012-10-01 17:32 2.4K 
[DIR]US - White Poverty Soars_files/2015-10-04 18:43 -  
[TXT]US Condemns 14 Countries for Human Trafficking.htm2012-10-01 17:33 2.1K 
[TXT]US Evangelicals Increasingly Question Pro-Zionist Heresy.htm2012-10-01 17:28 2.3K 
[DIR]US Evangelicals Increasingly Question Pro-Zionist Heresy_files/2015-10-04 18:43 -  
[TXT]US Iraq Atrocities Nothing New.htm2012-10-01 17:31 4.5K 
[DIR]US Iraq Atrocities Nothing New_files/2015-10-04 18:43 -  
[TXT]US Left - Tools of Oligarchs, Zionists, System.htm2012-10-01 17:31 4.8K 
[DIR]US Left - Tools of Oligarchs, Zionists, System_files/2015-10-04 18:43 -  
[TXT]US Nationalists Record Song for BNP.htm2012-10-01 17:29 3.3K 
[DIR]US Nationalists Record Song for BNP_files/2015-10-04 18:43 -  
[TXT]US Provided KLA With Food.htm2012-10-01 17:28 2.3K 
[DIR]US Provided KLA With Food_files/2015-10-04 18:43 -  
[TXT]USS LIBERTY Memorial - AMERICAN LEADERS SUPPORT USS Liberty SURVIVORS.htm2012-10-01 17:28 84K 
[DIR]USS LIBERTY Memorial - AMERICAN LEADERS SUPPORT USS Liberty SURVIVORS_files/2015-10-04 18:43 -  
[TXT]USS Liberty Veterans Present Pentagon With Report on Israeli War Crimes.htm2012-10-01 17:31 33K 
[DIR]USS Liberty Veterans Present Pentagon With Report on Israeli War Crimes_files/2015-10-04 18:43 -  
[TXT]Ugly Lessons from Katrina.htm2012-10-01 17:28 3.7K 
[DIR]Ugly Lessons from Katrina_files/2015-10-04 18:43 -  
[TXT]Ukraine - David Duke Earns Doctorate in History.htm2012-10-01 17:33 12K 
[DIR]Ukraine - David Duke Earns Doctorate in History_files/2015-10-04 18:43 -  
[TXT]Ulster - Anti-White Loyalist Thug Slain.htm2012-10-01 17:32 7.4K 
[DIR]Ulster - Anti-White Loyalist Thug Slain_files/2015-10-04 18:43 -  
[TXT]Ulster - Loyalists Join Jews in Human Smuggling Ring.htm2012-10-01 17:27 5.7K 
[DIR]Ulster - Loyalists Join Jews in Human Smuggling Ring_files/2015-10-04 18:43 -  
[TXT]Ulster - Religious Fanatics Say No To Catholics, Yes To Non-Whites.htm2012-10-01 17:27 3.8K 
[DIR]Ulster - Religious Fanatics Say No To Catholics, Yes To Non-Whites_files/2015-10-04 18:43 -  
[TXT]Ulster-Scots Culture Enjoys a Renaissance.htm2012-10-01 17:31 3.9K 
[DIR]Ulster-Scots Culture Enjoys a Renaissance_files/2015-10-04 18:43 -  
[   ]Underst_White_Priv.pdf2012-10-01 17:27 1.0M 
[   ]UnderstandingJewInfluence.pdf2012-10-01 17:33 240K 
[   ]UniqueWesternCulture.pdf2012-10-01 17:28 137K 
[TXT]Updated - Who Rules America.htm2012-10-01 17:30 50K 
[DIR]Updated - Who Rules America_files/2015-10-04 18:43 -  
[   ]Uprising.pdf2012-10-01 17:32 2.5M 
[TXT]Usury Perfected.htm2012-10-01 17:28 2.1K 
[DIR]Usury Perfected_files/2015-10-04 18:43 -  
[TXT]Utahns Leaving Multiracial Public Schools.htm2012-10-01 17:30 3.2K 
[DIR]Utahns Leaving Multiracial Public Schools_files/2015-10-04 18:43 -  
[TXT]V-News.org Exclusive - The Plan De San Diego.htm2012-10-01 17:31 6.3K 
[DIR]V-News.org Exclusive - The Plan De San Diego_files/2015-10-04 18:43 -  
[   ]VH.zip2012-10-01 17:31 1.9M 
[TXT]Vang Guilty in Hunter Massacre Trial.htm2012-10-01 17:30 3.9K 
[DIR]Vang Guilty in Hunter Massacre Trial_files/2015-10-04 18:43 -  
[TXT]Vang Says Three Hunters Deserved to Die.htm2012-10-01 17:34 2.8K 
[DIR]Vang Says Three Hunters Deserved to Die_files/2015-10-04 18:43 -  
[TXT]Vanguard News Network » Blog Archive » Important Thoughts, Financial and Economic Advice.htm2012-10-01 17:30 115K 
[DIR]Vanguard News Network » Blog Archive » Important Thoughts, Financial and Economic Advice_files/2015-10-04 18:43 -  
[TXT]Vanunu - Israel's Nuclear Arsenal a Threat to Middle East.htm2012-10-01 17:32 4.1K 
[DIR]Vanunu - Israel's Nuclear Arsenal a Threat to Middle East_files/2015-10-04 18:43 -  
[TXT]Venezuelan Chavez wants to be world's anti-U.S. voice.htm2012-10-01 17:30 10K 
[DIR]Venezuelan Chavez wants to be world's anti-U.S. voice_files/2015-10-04 18:43 -  
[TXT]Veteran Congressman Paul Findley Exposes Israel’s Lobby.htm2012-10-01 17:32 7.3K 
[DIR]Veteran Congressman Paul Findley Exposes Israel’s Lobby_files/2015-10-04 18:43 -  
[TXT]Vigilantes Attack Elderly Border Protestors.htm2012-10-01 17:33 3.4K 
[DIR]Vigilantes Attack Elderly Border Protestors_files/2015-10-04 18:43 -  
[TXT]Viktor Schauberger.txt2012-10-01 17:33 11K 
[TXT]Viroqua, WI School Board Bans 'Diversity Day'.htm2012-10-01 17:31 6.0K 
[DIR]Viroqua, WI School Board Bans 'Diversity Day'_files/2015-10-04 18:43 -  
[   ]VirusHouse.pdf2012-10-01 17:31 2.0M 
[   ]Vof64-1.pdf2012-10-01 17:31 1.6M 
[   ]Vof64-2.pdf2012-10-01 17:31 629K 
[   ]Vof64-3.pdf2012-10-01 17:28 649K 
[   ]Vof64-4.pdf2012-10-01 17:31 915K 
[   ]Vof64-5.pdf2012-10-01 17:27 344K 
[   ]Vof64-6.pdf2012-10-01 17:33 543K 
[   ]Vof64-7.pdf2012-10-01 17:31 564K 
[   ]Vof64-8.pdf2012-10-01 17:28 8.0M 
[   ]Vof64-9.pdf2012-10-01 17:34 8.6M 
[   ]Vof64-10.pdf2012-10-01 17:27 655K 
[   ]Vof64-11.pdf2012-10-01 17:32 831K 
[   ]Vof64-12.pdf2012-10-01 17:28 463K 
[   ]Vof64-13.pdf2012-10-01 17:33 1.0M 
[   ]Vof64-14.pdf2012-10-01 17:33 1.0M 
[   ]Vof64-15.pdf2012-10-01 17:34 2.1M 
[   ]Vof64-16.pdf2012-10-01 17:28 3.2M 
[TXT]Voice For Europe - Pan-European Co-ordination Against Turkish EU Membership.htm2012-10-01 17:27 3.2K 
[DIR]Voice For Europe - Pan-European Co-ordination Against Turkish EU Membership_files/2015-10-04 18:43 -  
[TXT]Voices from the Past - Languages of Our Ancestors.htm2012-10-01 17:31 3.4K 
[DIR]Voices from the Past - Languages of Our Ancestors_files/2015-10-04 18:43 -  
[TXT]Voodoo Faithful on Annual Pilgrimage.htm2012-10-01 17:34 3.1K 
[DIR]Voodoo Faithful on Annual Pilgrimage_files/2015-10-04 18:43 -  
[TXT]Voting for Pro-White Parties Is 'Spitting in God's Face'.htm2012-10-01 17:33 4.8K 
[DIR]Voting for Pro-White Parties Is 'Spitting in God's Face'_files/2015-10-04 18:43 -  
[   ]WAR_AryanUpdates2003_02_01_00_99.pdf2012-10-01 17:31 3.4M 
[   ]WAR_AryanUpdates2004_03_02.pdf2012-10-01 17:31 3.3M 
[TXT]WAS THERE REALLY A HOLOCAUST.htm2012-10-01 17:28 20K 
[DIR]WAS THERE REALLY A HOLOCAUST_files/2015-10-04 18:43 -  
[   ]WATCHING.pdf2012-10-01 17:27 81K 
[VID]WKRC_UAS.wmv2012-10-01 17:28 5.8M 
[   ]WPP Guidelines.pdf2012-10-01 17:33 21K 
[   ]WPP Petition.pdf2012-10-01 17:27 723K 
[   ]WPP Platform.pdf2012-10-01 17:31 58K 
[TXT]WSCwrote1920.html2012-10-01 17:33 11K 
[   ]WTC 911 plot.pdf2012-10-01 17:31 335K 
[   ]WTC_1page.pdf2012-10-01 17:33 5.3M 
[TXT]Wal-Mart Turns in Student’s Anti-Bush Photo, Secret Service Investigates Him.htm2012-10-01 17:30 4.0K 
[DIR]Wal-Mart Turns in Student’s Anti-Bush Photo, Secret Service Investigates Him_files/2015-10-04 18:43 -  
[DIR]Waldorf MW I Manuals/2015-10-04 18:43 -  
[TXT]Wales - Win for 'Heretic'.htm2012-10-01 17:33 4.2K 
[DIR]Wales - Win for 'Heretic'_files/2015-10-04 18:43 -  
[   ]WalkerIndictment.pdf2012-10-01 17:33 150K 
[   ]WallStreetCommieRevolution.pdf2012-10-01 17:31 586K 
[   ]WarBetweenGenerals.pdf2012-10-01 17:33 3.6M 
[TXT]War Criminal at Bay.htm2012-10-01 17:31 3.9K 
[DIR]War Criminal at Bay_files/2015-10-04 18:43 -  
[   ]WarIsARacket.pdf2012-10-01 17:30 43K 
[TXT]War Party Atrocity Porn.htm2012-10-01 17:30 2.9K 
[DIR]War Party Atrocity Porn_files/2015-10-04 18:43 -  
[   ]WarPath.pdf2012-10-01 17:31 2.4M 
[TXT]War Signals.htm2012-10-01 17:32 2.9K 
[DIR]War Signals_files/2015-10-04 18:43 -  
[TXT]Was Columbus Greek.htm2012-10-01 17:31 6.0K 
[DIR]Was Columbus Greek_files/2015-10-04 18:43 -  
[TXT]Was WWII Worth It.htm2012-10-01 17:29 6.7K 
[DIR]Was WWII Worth It_files/2015-10-04 18:43 -  
[TXT]Watts Riots 40 Years On.htm2012-10-01 17:33 2.8K 
[DIR]Watts Riots 40 Years On_files/2015-10-04 18:43 -  
[   ]WausauImmigration.pdf2012-10-01 17:30 39K 
[   ]WausauImmigration.rtf2012-10-01 17:28 64K 
[TXT]We The People.htm2012-10-01 17:33 3.7K 
[DIR]We The People_files/2015-10-04 18:43 -  
[   ]WealthOfNations.pdf2012-10-01 17:28 1.4M 
[TXT]We at The Scriptorium.htm2012-10-01 17:33 16K 
[DIR]We at The Scriptorium_files/2015-10-04 18:43 -  
[TXT]Welcome, TAA#3 readers - Background on our authors subjects.htm2012-10-01 17:33 71K 
[DIR]Welcome, TAA#3 readers - Background on our authors subjects_files/2015-10-04 18:43 -  
[TXT]Welcome News - Turks May 'Shun' EU Talks.htm2012-10-01 17:31 3.7K 
[DIR]Welcome News - Turks May 'Shun' EU Talks_files/2015-10-04 18:43 -  
[TXT]Welcome to the Jungle - Superdome Tales.htm2012-10-01 17:31 3.0K 
[DIR]Welcome to the Jungle - Superdome Tales_files/2015-10-04 18:43 -  
[TXT]Wendy Campbell - 2006-09-11 - Parallels between Nazism, Zionists striking.htm2012-10-01 17:30 30K 
[DIR]Wendy Campbell - 2006-09-11 - Parallels between Nazism, Zionists striking_files/2015-10-04 18:43 -  
[TXT]What's This About 'Peak Oil'.htm2012-10-01 17:33 4.5K 
[DIR]What's This About 'Peak Oil'_files/2015-10-04 18:43 -  
[TXT]What's Your Diversity Quotient.htm2012-10-01 17:31 15K 
[DIR]What's Your Diversity Quotient_files/2015-10-04 18:43 -  
[TXT]What's in the New Orleans Water.htm2012-10-01 17:29 5.5K 
[DIR]What's in the New Orleans Water_files/2015-10-04 18:43 -  
[TXT]What About 'Affirmative Action' for US Media Ownership.htm2012-10-01 17:28 15K 
[DIR]What About 'Affirmative Action' for US Media Ownership_files/2015-10-04 18:43 -  
[TXT]What Does Israel Want.htm2012-10-01 17:31 2.6K 
[DIR]What Does Israel Want_files/2015-10-04 18:43 -  
[TXT]What Makes Palestinians Think They Can.htm2012-10-01 17:28 7.6K 
[DIR]What Makes Palestinians Think They Can_files/2015-10-04 18:43 -  
[TXT]What Makes Western Culture Unique.htm2012-10-01 17:29 4.8K 
[DIR]What Makes Western Culture Unique_files/2015-10-04 18:43 -  
[   ]WhatTheTalmudTeaches.pdf2012-10-01 17:34 213K 
[TXT]What Would War Look Like.htm2012-10-01 17:32 5.4K 
[DIR]What Would War Look Like_files/2015-10-04 18:43 -  
[   ]What is National Vanguard - intro.pdf2012-10-01 17:32 1.4M 
[TXT]What is National Vanguard.htm2012-10-01 17:31 23K 
[DIR]What is National Vanguard_files/2015-10-04 18:43 -  
[TXT]What is So Wrong With White People.htm2012-10-01 17:31 8.2K 
[DIR]What is So Wrong With White People_files/2015-10-04 18:43 -  
[TXT]What will become of the ‘American Dream’.htm2012-10-01 17:31 4.9K 
[DIR]What will become of the ‘American Dream’_files/2015-10-04 18:43 -  
[TXT]Wheat and Chaff.htm2012-10-01 17:33 4.1K 
[DIR]Wheat and Chaff_files/2015-10-04 18:43 -  
[TXT]When Al Qaeda Was An Ally of 'the West'.htm2012-10-01 17:31 4.7K 
[DIR]When Al Qaeda Was An Ally of 'the West'_files/2015-10-04 18:43 -  
[   ]When In Our Music God Is Glorified.doc2012-10-01 17:27 21K 
[TXT]Which Way, Milwaukee.htm2012-10-01 17:31 15K 
[DIR]Which Way, Milwaukee_files/2015-10-04 18:43 -  
[   ]WhiteAmerica.pdf2012-10-01 17:32 528K 
[TXT]White America starts winning.htm2012-10-01 17:31 7.0K 
[DIR]White America starts winning_files/2015-10-04 18:43 -  
[TXT]White Children Experience Slavery at Summer Camp.htm2012-10-01 17:30 3.0K 
[DIR]White Children Experience Slavery at Summer Camp_files/2015-10-04 18:43 -  
[TXT]White Heritage Sites Threatened on Cyprus.htm2012-10-01 17:33 3.8K 
[DIR]White Heritage Sites Threatened on Cyprus_files/2015-10-04 18:43 -  
[TXT]White India.htm2012-10-01 17:27 4.7K 
[DIR]White India_files/2015-10-04 18:43 -  
[TXT]White Interests.htm2012-10-01 17:33 3.1K 
[DIR]White Interests_files/2015-10-04 18:43 -  
[   ]WhiteMansBibleOrig.pdf2012-10-01 17:28 1.3M 
[   ]White Nationalist Position Statements.pdf2012-10-01 17:27 56K 
[TXT]White Nationalist Position Statements.txt2012-10-01 17:30 7.0K 
[TXT]White People's Party Forms in Nevada.htm2012-10-01 17:34 5.4K 
[DIR]White People's Party Forms in Nevada_files/2015-10-04 18:43 -  
[   ]WhitePower.pdf2012-10-01 17:27 766K 
[TXT]White Science, Black Humor.htm2012-10-01 17:30 14K 
[DIR]White Science, Black Humor_files/2015-10-04 18:43 -  
[   ]WhiteSlaveryBibliography.pdf2012-10-01 17:27 72K 
[TXT]White Slavery Focus of New Book.htm2012-10-01 17:32 2.6K 
[DIR]White Slavery Focus of New Book_files/2015-10-04 18:43 -  
[TXT]White Teen Dragged from Bus, Beaten, and Robbed by Anti-White Gang Members.htm2012-10-01 17:31 2.3K 
[DIR]White Teen Dragged from Bus, Beaten, and Robbed by Anti-White Gang Members_files/2015-10-04 18:43 -  
[TXT]White Wire Newsblog » A History of Kwanza by Ann Coulter…and a Special Kwanza Jingle From the White Wire Staff.htm2012-10-01 17:33 21K 
[DIR]White Wire Newsblog » A History of Kwanza by Ann Coulter…and a Special Kwanza Jingle From the White Wire Staff_files/2015-10-04 18:43 -  
[TXT]Whites Make Stand at Superdome.htm2012-10-01 17:31 3.2K 
[DIR]Whites Make Stand at Superdome_files/2015-10-04 18:43 -  
[TXT]Whites Organize in Namibia.htm2012-10-01 17:31 2.8K 
[DIR]Whites Organize in Namibia_files/2015-10-04 18:43 -  
[TXT]Whites Repulse Turks in Georgian Waters.htm2012-10-01 17:33 5.3K 
[DIR]Whites Repulse Turks in Georgian Waters_files/2015-10-04 18:43 -  
[TXT]Whites Suffering in New Orleans.htm2012-10-01 17:27 3.2K 
[DIR]Whites Suffering in New Orleans_files/2015-10-04 18:43 -  
[TXT]Who Brought the Slaves to America -- part II of II.htm2012-10-01 17:31 28K 
[TXT]Who Brought the Slaves to America -- part I of II.htm2012-10-01 17:31 21K 
[TXT]Who Rules America.htm2012-10-01 17:32 50K 
[   ]WhoRulesAmerica.pdf2012-10-01 17:31 51K 
[DIR]Who Rules America_files/2015-10-04 18:43 -  
[TXT]Who We Sold the Serbs To.htm2012-10-01 17:33 6.6K 
[DIR]Who We Sold the Serbs To_files/2015-10-04 18:43 -  
[   ]WhoWillFeedChina.pdf2012-10-01 17:30 43K 
[TXT]Why Hitler Attacked Soviet Russia When He Did.htm2012-10-01 17:31 32K 
[DIR]Why Hitler Attacked Soviet Russia When He Did_files/2015-10-04 18:43 -  
[TXT]Why Islam Didn't Conquer the World.htm2012-10-01 17:30 6.6K 
[DIR]Why Islam Didn't Conquer the World_files/2015-10-04 18:43 -  
[TXT]Why Israel’s Campaign in Lebanon is Failing.htm2012-10-01 17:33 8.8K 
[DIR]Why Israel’s Campaign in Lebanon is Failing_files/2015-10-04 18:43 -  
[TXT]Why Scandinavia Tops U.N. Standard of Living Index.htm2012-10-01 17:31 3.8K 
[DIR]Why Scandinavia Tops U.N. Standard of Living Index_files/2015-10-04 18:43 -  
[   ]WichitaMassacre.pdf2012-10-01 17:28 520K 
[   ]WichitaMassacreHomepage.pdf2012-10-01 17:30 958K 
[TXT]Wife-Beating Drug Addict Demands Custody Of Prussian Blue.txt2012-10-01 17:30 2.2K 
[   ]Wife19.pdf2012-10-01 17:33 8.1M 
[   ]WinterSonnenWend.pdf2012-10-01 17:31 1.5M 
[TXT]Wisconsin - New Flood of Hmong Refugees Will Strain Already Tight Budgets.htm2012-10-01 17:33 5.7K 
[DIR]Wisconsin - New Flood of Hmong Refugees Will Strain Already Tight Budgets_files/2015-10-04 18:43 -  
[TXT]Wisconsin - Rampage Killer, Friends Now Suspects in 2001 Homicide.htm2012-10-01 17:27 7.1K 
[DIR]Wisconsin - Rampage Killer, Friends Now Suspects in 2001 Homicide_files/2015-10-04 18:43 -  
[TXT]Wisconsin Loves Its Non-Whites Too.htm2012-10-01 17:31 5.8K 
[TXT]Witnesses - New Orleans Cops are Looters.htm2012-10-01 17:28 3.2K 
[DIR]Witnesses - New Orleans Cops are Looters_files/2015-10-04 18:43 -  
[TXT]Worldwide Lack of Concern Over Israel's White Slave Trade.htm2012-10-01 17:33 4.5K 
[DIR]Worldwide Lack of Concern Over Israel's White Slave Trade_files/2015-10-04 18:43 -  
[TXT]YGGDRASIL - Lesson Number One.htm2012-10-01 17:27 21K 
[DIR]YGGDRASIL - Lesson Number One_files/2015-10-04 18:43 -  
[DIR]Ygg/2012-10-01 17:28 -  
[   ]YggLibraryFull.pdf2012-10-01 17:31 4.3M 
[   ]YggdrasilsLibrary.pdf2012-10-01 17:30 3.1M 
[TXT]Youth Gang Rape Reported in Milwaukee.htm2012-10-01 17:28 6.5K 
[DIR]Youth Gang Rape Reported in Milwaukee_files/2015-10-04 18:43 -  
[TXT]Zimbabwe - Armed Police Stealing Farm Equipment.htm2012-10-01 17:28 3.9K 
[DIR]Zimbabwe - Armed Police Stealing Farm Equipment_files/2015-10-04 18:43 -  
[TXT]Zimbabwe - Monkey Behind Famine.htm2012-10-01 17:31 3.2K 
[DIR]Zimbabwe - Monkey Behind Famine_files/2015-10-04 18:43 -  
[   ]ZionismInAgeOfDictators.pdf2012-10-01 17:28 1.3M 
[   ]ZionistAntiSemitism.pdf2012-10-01 17:28 33K 
[TXT]Zionist Shill's Mistake Endangers Family.htm2012-10-01 17:28 3.9K 
[DIR]Zionist Shill's Mistake Endangers Family_files/2015-10-04 18:43 -  
[TXT]Zionist Televangelist Paid Hush Money in 'Gay' Scandal.htm2012-10-01 17:30 4.1K 
[DIR]Zionist Televangelist Paid Hush Money in 'Gay' Scandal_files/2015-10-04 18:43 -  
[TXT]Zionist Thug Invaders Stir Plate of Violence for Passover Celebrations, Celebrate the Cruel Killing of Innocent Egyptian Children 3,000 Years Ago..html2012-10-01 17:31 14K 
[TXT]Zionists Cheer Creep DeLay.htm2012-10-01 17:28 3.7K 
[DIR]Zionists Cheer Creep DeLay_files/2015-10-04 18:43 -  
[TXT]Zionists Show Contempt For Christians.htm2012-10-01 17:28 3.4K 
[DIR]Zionists Show Contempt For Christians_files/2015-10-04 18:43 -  
[TXT]Zionists Slam Greeks.htm2012-10-01 17:30 3.9K 
[DIR]Zionists Slam Greeks_files/2015-10-04 18:43 -  
[TXT]Zionists Threaten Leader with Occult Ritual Murder.htm2012-10-01 17:28 8.0K 
[DIR]Zionists Threaten Leader with Occult Ritual Murder_files/2015-10-04 18:43 -  
[   ]ZweitesBuch.pdf2012-10-01 17:32 325K 
[   ]ZyklonAd-War.pdf2012-10-01 17:33 313K 
[TXT]about - THE CHURCH OF TRUE ISRAEL.html2012-10-01 17:34 6.8K 
[   ]adaptanddie.pdf2012-10-01 17:31 365K 
[   ]adaptanddie.rtf2012-10-01 17:28 186K 
[   ]adlfactsheet1.pdf2012-10-01 17:27 189K 
[TXT]adv-music.html2012-10-01 17:34 2.7K 
[TXT]adv-tapes.html2012-10-01 17:33 9.1K 
[TXT]adv010194.html2012-10-01 17:29 22K 
[TXT]adv010894.html2012-10-01 17:29 17K 
[TXT]adv011594.html2012-10-01 17:33 17K 
[TXT]adv012994.html2012-10-01 17:28 21K 
[TXT]adv020594.html2012-10-01 17:31 18K 
[TXT]adv021994.html2012-10-01 17:33 20K 
[TXT]adv022093.html2012-10-01 17:31 19K 
[TXT]adv022496.html2012-10-01 17:31 15K 
[TXT]adv022793.html2012-10-01 17:34 18K 
[TXT]adv030594.html2012-10-01 17:30 20K 
[TXT]adv031294.html2012-10-01 17:30 20K 
[TXT]adv031393.html2012-10-01 17:28 19K 
[TXT]adv031994.html2012-10-01 17:31 22K 
[TXT]adv032093.html2012-10-01 17:32 17K 
[TXT]adv040293.html2012-10-01 17:28 18K 
[TXT]adv040393.html2012-10-01 17:33 6.0K 
[TXT]adv041093.html2012-10-01 17:27 16K 
[TXT]adv042493.html2012-10-01 17:31 19K 
[TXT]adv043094.html2012-10-01 17:28 17K 
[TXT]adv050193.html2012-10-01 17:29 20K 
[TXT]adv050794.html2012-10-01 17:28 18K 
[TXT]adv052993.html2012-10-01 17:30 19K 
[TXT]adv060593.html2012-10-01 17:28 20K 
[TXT]adv061293.html2012-10-01 17:28 22K 
[TXT]adv061993.html2012-10-01 17:30 21K 
[TXT]adv071093a.html2012-10-01 17:28 18K 
[TXT]adv071093b.html2012-10-01 17:30 20K 
[TXT]adv072493.html2012-10-01 17:28 20K 
[TXT]adv080793.html2012-10-01 17:29 21K 
[TXT]adv081493.html2012-10-01 17:34 20K 
[TXT]adv082193.html2012-10-01 17:30 20K 
[TXT]adv082893.html2012-10-01 17:33 20K 
[TXT]adv091193.html2012-10-01 17:34 19K 
[TXT]adv091893.html2012-10-01 17:31 16K 
[TXT]adv092593.html2012-10-01 17:33 19K 
[   ]adv10-15-05.pdf2012-10-01 17:33 296K 
[TXT]adv100293.html2012-10-01 17:33 20K 
[TXT]adv100792.html2012-10-01 17:32 19K 
[TXT]adv101594.html2012-10-01 17:30 61K 
[TXT]adv102393.html2012-10-01 17:30 20K 
[TXT]adv103093.html2012-10-01 17:31 17K 
[TXT]adv110693.html2012-10-01 17:31 18K 
[TXT]adv111393.html2012-10-01 17:27 18K 
[TXT]adv120493.html2012-10-01 17:33 18K 
[TXT]adv122593.html2012-10-01 17:30 20K 
[   ]aet.pdf2012-10-01 17:33 1.5M 
[   ]after_apartheid.pdf2012-10-01 17:28 770K 
[TXT]agapintestscoresbecomesatalkingpoint.html2012-10-01 17:33 7.5K 
[   ]aids.pdf2012-10-01 17:34 261K 
[TXT]aidsworkersbattlemythandignorance.html2012-10-01 17:27 6.5K 
[   ]aidtoisrael.pdf2012-10-01 17:34 96K 
[   ]airport_flier_1.pdf2012-10-01 17:33 239K 
[   ]allies.pdf2012-10-01 17:33 593K 
[   ]american_haters2.pdf2012-10-01 17:34 704K 
[   ]amusing_bible.zip2012-10-01 17:33 365K 
[   ]amusing_gospel.zip2012-10-01 17:34 341K 
[TXT]antichrist.htm2012-10-01 17:33 198K 
[TXT]antiracism.htm2012-10-01 17:33 48K 
[   ]antisemitismcauses.pdf2012-10-01 17:29 1.0M 
[   ]antisemitismcauses.rtf2012-10-01 17:34 548K 
[TXT]apology.htm2012-10-01 17:28 14K 
[   ]application.pdf2012-10-01 17:31 396K 
[   ]arabtransfer.pdf2012-10-01 17:30 2.1M 
[   ]arabtransfer.rtf2012-10-01 17:31 1.6M 
[   ]areyouawhiteman.pdf2012-10-01 17:33 62K 
[TXT]article7545.htm2012-10-01 17:33 14K 
[   ]asgard-pdf.zip2012-10-01 17:32 823K 
[TXT]audio.html2012-10-01 17:30 58K 
[TXT]audiovideo2.htm2012-10-01 17:29 33K 
[   ]auschwitzbunkers.pdf2012-10-01 17:33 6.2M 
[   ]auschwitzplainfacts.pdf2012-10-01 17:29 1.5M 
[   ]auschwitzplainfacts.rtf2012-10-01 17:33 2.1M 
[TXT]av.html2012-10-01 17:27 57K 
[   ]awmso.rtf2012-10-01 17:33 568K 
[   ]awmso.zip2012-10-01 17:32 454K 
[TXT]baraktriestoresolveplanedispute.html2012-10-01 17:33 5.8K 
[   ]barriers.pdf2012-10-01 17:34 246K 
[   ]belzec.pdf2012-10-01 17:28 3.0M 
[   ]bengurionscandals.pdf2012-10-01 17:31 514K 
[   ]bengurionscandals.rtf2012-10-01 17:32 681K 
[   ]beria.pdf2012-10-01 17:28 318K 
[TXT]biblography.html2012-10-01 17:28 8.2K 
[   ]binLadenInterview.pdf2012-10-01 17:27 79K 
[   ]biohazard.pdf2012-10-01 17:33 285K 
[   ]biologicaljew.pdf2012-10-01 17:31 245K 
[   ]biologicaljew.rtf2012-10-01 17:33 325K 
[   ]bks.bin2012-10-01 17:29 10K 
[   ]black_history_month_1.pdf2012-10-01 17:31 731K 
[TXT]blackamericaatwar.html2012-10-01 17:32 3.5K 
[   ]blackboxvoting.pdf2012-10-01 17:28 972K 
[   ]blackcrime.pdf2012-10-01 17:32 409K 
[TXT]blackpupilslagdespiteeconomicstatus.html2012-10-01 17:28 6.6K 
[TXT]blackpupilslosingoutindrivetoraisestandards.html2012-10-01 17:31 3.1K 
[TXT]blackscanthackcollegeegalitariansbaffled.html2012-10-01 17:31 13K 
[TXT]blackscommit90percentofinterracialcrime.html2012-10-01 17:30 10K 
[TXT]blackswontgofarinparalleluniverse.html2012-10-01 17:31 4.2K 
[TXT]blackyouthcultureblamedaspupilsfail.html2012-10-01 17:28 5.8K 
[   ]blfs-book-6.1.pdf2012-10-01 17:30 3.2M 
[IMG]bolshevism.jpg2012-10-01 17:27 18K 
[   ]book_of_dead.zip2012-10-01 17:33 1.1M 
[TXT]books-immigration.html2012-10-01 17:28 184K 
[DIR]books-immigration_files/2015-10-04 18:43 -  
[   ]boredoftherings.pdf2012-10-01 17:31 230K 
[   ]boredoftherings.rtf2012-10-01 17:31 332K 
[IMG]born_to_kill.jpg2012-10-01 17:31 13K 
[   ]boycott_hd.pdf2012-10-01 17:29 861K 
[   ]brann.pdf2012-10-01 17:31 67K 
[   ]breaking point.pdf2012-10-01 17:28 98K 
[TXT]brenner02192003.html2012-10-01 17:32 23K 
[TXT]bringingdemocracytohaiti.html2012-10-01 17:32 27K 
[   ]brochure.pdf2012-10-01 17:31 1.9M 
[   ]bush_911_2005.pdf2012-10-01 17:30 219K 
[IMG]bushpoint2.jpg2012-10-01 17:31 7.3K 
[   ]bwbw.pdf2012-10-01 17:33 1.0M 
[   ]carplans.zip2012-10-01 17:32 218K 
[   ]catalog.pdf2012-10-01 17:29 511K 
[TXT]catalog_pdf0607.htm2012-10-01 17:31 7.4K 
[   ]ccm.pdf2012-10-01 17:31 9.1M 
[   ]ccm.zip2012-10-01 17:33 3.0M 
[   ]ccs.pdf2012-10-01 17:31 8.3M 
[   ]cgc 1.pdf2012-10-01 17:33 2.4M 
[   ]cgc2.pdf2012-10-01 17:30 2.9M 
[   ]cgc3.pdf2012-10-01 17:29 1.3M 
[TXT]chapter01.html2012-10-01 17:32 4.0K 
[TXT]chapter02.html2012-10-01 17:32 8.0K 
[TXT]chapter03.html2012-10-01 17:32 11K 
[TXT]chapter04.html2012-10-01 17:30 5.4K 
[TXT]chapter05.html2012-10-01 17:31 5.3K 
[TXT]chapter06.html2012-10-01 17:31 12K 
[TXT]chapter07.html2012-10-01 17:28 15K 
[TXT]chapter08.html2012-10-01 17:32 20K 
[TXT]chapter09.html2012-10-01 17:30 4.4K 
[TXT]chapter10.html2012-10-01 17:33 34K 
[TXT]chapter11.html2012-10-01 17:32 14K 
[TXT]chapter12.html2012-10-01 17:28 17K 
[TXT]chapter13.html2012-10-01 17:33 13K 
[TXT]chapter14.html2012-10-01 17:33 8.5K 
[TXT]chapter15.html2012-10-01 17:31 21K 
[TXT]chapter16.html2012-10-01 17:30 7.3K 
[TXT]chapter17.html2012-10-01 17:32 8.2K 
[TXT]chapter18.html2012-10-01 17:29 6.1K 
[TXT]chapter19.html2012-10-01 17:33 10K 
[TXT]chapter20.html2012-10-01 17:29 6.5K 
[   ]chickenhawks.pdf2012-10-01 17:34 1.2M 
[TXT]chinacautionsisraelagainstsellingawacstoindia.html2012-10-01 17:31 3.5K 
[TXT]chinadeploysdronesfromisrael.html2012-10-01 17:34 6.9K 
[TXT]chinapreparesforwaragainsttheunitedstates.html2012-10-01 17:30 4.5K 
[TXT]chinasarsenalborninamerica.html2012-10-01 17:28 9.0K 
[TXT]chinesespyingandthewhitehouse.html2012-10-01 17:32 12K 
[   ]churchillswar1.pdf2012-10-01 17:32 5.8M 
[   ]churchillswar2.pdf2012-10-01 17:31 5.1M 
[   ]ci.zip2012-10-01 17:31 909K 
[TXT]classical_iq_r2.cgi.htm2012-10-01 17:33 24K 
[   ]clinton.pdf2012-10-01 17:31 72K 
[   ]cofc.pdf2012-10-01 17:29 1.9M 
[   ]collective_punishment.pdf2012-10-01 17:33 218K 
[   ]color-brochure.pdf2012-10-01 17:33 572K 
[TXT]color2.html2012-10-01 17:29 8.7K 
[   ]colorcrime99.pdf2012-10-01 17:29 400K 
[   ]come-and-hear-complete.zip2012-10-01 17:28 58M 
[   ]coming_soon.pdf2012-10-01 17:33 479K 
[TXT]comm_1.html2012-10-01 17:33 48K 
[TXT]communist.html2012-10-01 17:32 44K 
[TXT]complaintform_advertising.htm2012-10-01 17:30 2.9K 
[TXT]complaintform_bank.htm2012-10-01 17:33 2.5K 
[TXT]complaintform_banquet_service.htm2012-10-01 17:33 2.7K 
[TXT]complaintform_barber_shop.htm2012-10-01 17:28 2.5K 
[TXT]complaintform_beauty_parlor.htm2012-10-01 17:28 2.6K 
[TXT]complaintform_church.htm2012-10-01 17:33 3.3K 
[TXT]complaintform_department_store.htm2012-10-01 17:30 2.6K 
[TXT]complaintform_ethnic_answering_service.htm2012-10-01 17:28 2.6K 
[TXT]complaintform_hair_salon.htm2012-10-01 17:31 2.5K 
[TXT]complaintform_hospital.htm2012-10-01 17:32 2.5K 
[TXT]complaintform_hotel.htm2012-10-01 17:31 2.5K 
[TXT]complaintform_motel.htm2012-10-01 17:32 2.5K 
[TXT]complaintform_movie_race_mixing.htm2012-10-01 17:33 2.9K 
[TXT]complaintform_news_show.htm2012-10-01 17:34 2.9K 
[TXT]complaintform_physician_office.htm2012-10-01 17:33 2.5K 
[TXT]complaintform_restaurant.htm2012-10-01 17:33 2.8K 
[TXT]complaintform_school.htm2012-10-01 17:32 2.7K 
[TXT]complaintform_service_station.htm2012-10-01 17:33 2.6K 
[TXT]complaintform_store.htm2012-10-01 17:30 2.5K 
[TXT]complaintform_theatre.htm2012-10-01 17:27 2.5K 
[   ]convoypq17.pdf2012-10-01 17:30 2.5M 
[   ]cosmoe.pdf2012-10-01 17:31 172K 
[   ]cosmosymbol.pdf2012-10-01 17:28 60K 
[TXT]coxreportisarealwhodunit.html2012-10-01 17:31 5.9K 
[TXT]creativity.html2012-10-01 17:32 21K 
[TXT]d2presid.html2012-10-01 17:30 5.2K 
[   ]dare.pdf2012-10-01 17:31 349K 
[   ]design.pdf2012-10-01 17:31 173K 
[   ]diversity.pdf2012-10-01 17:31 503K 
[   ]doles.pdf2012-10-01 17:33 61K 
[TXT]downedchinesef8carriedisraelimissile.html2012-10-01 17:30 2.0K 
[   ]dresden.pdf2012-10-01 17:28 1.0M 
[   ]dresden1995.pdf2012-10-01 17:31 764K 
[TXT]dropthelist.htm2012-10-01 17:32 22K 
[   ]dth.pdf2012-10-01 17:28 16M 
[   ]dth.zip2012-10-01 17:30 6.0M 
[   ]ec.pdf2012-10-01 17:32 906K 
[TXT]einstein-prioritymyth.htm2012-10-01 17:30 21K 
[DIR]einstein-prioritymyth_files/2015-10-04 18:43 -  
[   ]en_gentiles - Gentiles in Halacha.zip2012-10-01 17:28 65K 
[   ]en_gentiles1 - Gentiles in Halacha.zip2012-10-01 17:32 8.3K 
[   ]endimmigration.pdf2012-10-01 17:33 91K 
[   ]essentialphysics1.pdf2012-10-01 17:30 948K 
[TXT]eugenics.htm2012-10-01 17:29 33K 
[TXT]eugenics.html2012-10-01 17:31 33K 
[   ]euvolution.pdf2012-10-01 17:28 3.7M 
[   ]exiles.zip2012-10-01 17:31 130K 
[TXT]failurerateonmathtestup50percentincounty.html2012-10-01 17:28 4.9K 
[TXT]fame.css2012-10-01 17:31 784  
[   ]fame.pdf2012-10-01 17:31 2.3M 
[   ]fame.zip2012-10-01 17:28 450K 
[   ]famedeadmansdeeds.pdf2012-10-01 17:34 2.3M 
[TXT]faq.html2012-10-01 17:27 58K 
[TXT]faq_francaise.html2012-10-01 17:33 59K 
[   ]feb03.pdf2012-10-01 17:28 1.6M 
[   ]fhe part1.pdf2012-10-01 17:27 14M 
[   ]fhe part2.pdf2012-10-01 17:33 9.9M 
[   ]fhe part3.pdf2012-10-01 17:31 15M 
[   ]fhe part4.pdf2012-10-01 17:30 7.3M 
[   ]fhe part5.pdf2012-10-01 17:32 5.4M 
[   ]fhe part6.pdf2012-10-01 17:29 4.7M 
[   ]fhe part7.pdf2012-10-01 17:27 3.6M 
[   ]fhe part8.pdf2012-10-01 17:31 4.2M 
[   ]fhe part9.pdf2012-10-01 17:32 14M 
[   ]fhe part10.pdf2012-10-01 17:34 9.6M 
[   ]fhe part11.pdf2012-10-01 17:33 6.9M 
[   ]fhe part12.pdf2012-10-01 17:28 857K 
[   ]first10years.doc2012-10-01 17:33 110K 
[TXT]fliers.html2012-10-01 17:34 44K 
[   ]foundingizzymyths.pdf2012-10-01 17:30 916K 
[   ]foundingizzymyths.rtf2012-10-01 17:29 526K 
[   ]frankdiaryfraud.pdf2012-10-01 17:30 111K 
[   ]free_irving.pdf2012-10-01 17:31 471K 
[   ]freeamericaflyer.pdf2012-10-01 17:32 127K 
[TXT]fs001a.html2012-10-01 17:32 19K 
[TXT]fs001b.html2012-10-01 17:34 19K 
[TXT]fs001c.html2012-10-01 17:32 19K 
[TXT]fs001d.html2012-10-01 17:33 19K 
[TXT]fs0010a.html2012-10-01 17:31 20K 
[TXT]fs0010b.html2012-10-01 17:31 20K 
[TXT]fs0010c.html2012-10-01 17:31 19K 
[TXT]fs0010d.html2012-10-01 17:28 20K 
[TXT]fs0011a.html2012-10-01 17:33 20K 
[TXT]fs0011b.html2012-10-01 17:33 20K 
[TXT]fs0011c.html2012-10-01 17:31 20K 
[TXT]fs0011d.html2012-10-01 17:31 20K 
[TXT]fs0012a.html2012-10-01 17:29 19K 
[TXT]fs0012b.html2012-10-01 17:32 20K 
[TXT]fs0012c.html2012-10-01 17:31 20K 
[TXT]fs0012d.html2012-10-01 17:31 19K 
[TXT]fs002a.html2012-10-01 17:28 19K 
[TXT]fs002b.html2012-10-01 17:32 19K 
[TXT]fs002c.html2012-10-01 17:27 19K 
[TXT]fs002d.html2012-10-01 17:33 20K 
[TXT]fs003a.html2012-10-01 17:33 20K 
[TXT]fs003b.html2012-10-01 17:29 20K 
[TXT]fs003c.html2012-10-01 17:29 19K 
[TXT]fs003d.html2012-10-01 17:31 20K 
[TXT]fs004a.html2012-10-01 17:29 20K 
[TXT]fs004b.html2012-10-01 17:31 19K 
[TXT]fs004c.html2012-10-01 17:31 19K 
[TXT]fs004d.html2012-10-01 17:33 20K 
[TXT]fs005a.html2012-10-01 17:28 20K 
[TXT]fs005b.html2012-10-01 17:29 20K 
[TXT]fs005c.html2012-10-01 17:29 20K 
[TXT]fs005d.html2012-10-01 17:30 19K 
[TXT]fs006a.html2012-10-01 17:31 20K 
[TXT]fs006b.html2012-10-01 17:30 20K 
[TXT]fs006c.html2012-10-01 17:29 20K 
[TXT]fs006d.html2012-10-01 17:28 20K 
[TXT]fs007a.html2012-10-01 17:31 20K 
[TXT]fs007b.html2012-10-01 17:31 20K 
[TXT]fs007c.html2012-10-01 17:29 20K 
[TXT]fs007d.html2012-10-01 17:33 20K 
[TXT]fs008a.html2012-10-01 17:31 19K 
[TXT]fs008b.html2012-10-01 17:28 20K 
[TXT]fs008c.html2012-10-01 17:31 20K 
[TXT]fs008d.html2012-10-01 17:33 20K 
[TXT]fs009a.html2012-10-01 17:33 20K 
[TXT]fs009b.html2012-10-01 17:32 19K 
[TXT]fs009c.html2012-10-01 17:31 20K 
[TXT]fs009d.html2012-10-01 17:33 19K 
[TXT]fs0101a.html2012-10-01 17:33 20K 
[TXT]fs0101b.html2012-10-01 17:28 20K 
[TXT]fs0101c.html2012-10-01 17:31 20K 
[TXT]fs0101d.html2012-10-01 17:33 20K 
[TXT]fs0102a.html2012-10-01 17:33 20K 
[TXT]fs0102b.html2012-10-01 17:30 20K 
[TXT]fs0102c.html2012-10-01 17:28 19K 
[TXT]fs0102d.html2012-10-01 17:32 20K 
[TXT]fs0103a.html2012-10-01 17:31 20K 
[TXT]fs0103b.html2012-10-01 17:30 20K 
[TXT]fs0103c.html2012-10-01 17:33 20K 
[TXT]fs0103d.html2012-10-01 17:28 20K 
[TXT]fs0104a.html2012-10-01 17:31 20K 
[TXT]fs0104b.html2012-10-01 17:31 20K 
[TXT]fs0104c.html2012-10-01 17:27 20K 
[TXT]fs0104d.html2012-10-01 17:31 20K 
[TXT]fs0105a.html2012-10-01 17:28 20K 
[TXT]fs0105b.html2012-10-01 17:28 20K 
[TXT]fs0105c.html2012-10-01 17:31 20K 
[TXT]fs0105d.html2012-10-01 17:33 19K 
[TXT]fs0106a.html2012-10-01 17:31 19K 
[TXT]fs0106b.html2012-10-01 17:28 20K 
[TXT]fs0106c.html2012-10-01 17:30 19K 
[TXT]fs0106d.html2012-10-01 17:34 20K 
[TXT]fs0107a.html2012-10-01 17:28 20K 
[TXT]fs0107b.html2012-10-01 17:32 20K 
[TXT]fs0107c.html2012-10-01 17:27 20K 
[TXT]fs0107d.html2012-10-01 17:31 20K 
[TXT]fs0108a.html2012-10-01 17:32 20K 
[TXT]fs0108b.html2012-10-01 17:31 20K 
[TXT]fs0108c.html2012-10-01 17:30 20K 
[TXT]fs0108d.html2012-10-01 17:31 19K 
[TXT]fs0109a.html2012-10-01 17:33 20K 
[TXT]fs0109b.html2012-10-01 17:31 20K 
[TXT]fs0109c.html2012-10-01 17:30 20K 
[TXT]fs0109d.html2012-10-01 17:31 20K 
[TXT]fs0110a.html2012-10-01 17:28 20K 
[TXT]fs0110b.html2012-10-01 17:34 22K 
[TXT]fs0110c.html2012-10-01 17:31 20K 
[TXT]fs0110d.html2012-10-01 17:33 20K 
[TXT]fs0111a.html2012-10-01 17:28 21K 
[TXT]fs0111b.html2012-10-01 17:28 20K 
[TXT]fs0111c.html2012-10-01 17:33 20K 
[TXT]fs0111d.html2012-10-01 17:31 21K 
[TXT]fs0112a.html2012-10-01 17:31 19K 
[TXT]fs0112b.html2012-10-01 17:28 20K 
[TXT]fs0112c.html2012-10-01 17:27 20K 
[TXT]fs0112d.html2012-10-01 17:31 20K 
[TXT]fs0201a.html2012-10-01 17:33 20K 
[TXT]fs0201b.html2012-10-01 17:33 20K 
[TXT]fs0201c.html2012-10-01 17:30 20K 
[TXT]fs0201d.html2012-10-01 17:32 20K 
[TXT]fs0202a.html2012-10-01 17:29 20K 
[TXT]fs0202b.html2012-10-01 17:29 20K 
[TXT]fs0202c.html2012-10-01 17:34 20K 
[TXT]fs0202d.html2012-10-01 17:32 21K 
[TXT]fs0203a.html2012-10-01 17:30 20K 
[TXT]fs0203b.html2012-10-01 17:32 20K 
[TXT]fs0203c.html2012-10-01 17:33 19K 
[TXT]fs0203d.html2012-10-01 17:27 20K 
[TXT]fs0204a.html2012-10-01 17:34 20K 
[TXT]fs0204b.html2012-10-01 17:28 19K 
[TXT]fs0204c.html2012-10-01 17:34 20K 
[TXT]fs0204d.html2012-10-01 17:28 20K 
[TXT]fs0205a.html2012-10-01 17:32 20K 
[TXT]fs0205b.html2012-10-01 17:31 20K 
[TXT]fs0205c.html2012-10-01 17:29 19K 
[TXT]fs0205d.html2012-10-01 17:31 20K 
[TXT]fs0206a.html2012-10-01 17:31 20K 
[TXT]fs0206b.html2012-10-01 17:28 20K 
[TXT]fs0206c.html2012-10-01 17:33 20K 
[TXT]fs0206d.html2012-10-01 17:34 20K 
[TXT]fs0207a.html2012-10-01 17:29 20K 
[TXT]fs0207b.html2012-10-01 17:31 19K 
[TXT]fs0207c.html2012-10-01 17:27 20K 
[TXT]fs0207d.html2012-10-01 17:29 20K 
[TXT]fs0208a.html2012-10-01 17:33 20K 
[TXT]fs0208b.html2012-10-01 17:27 19K 
[TXT]fs0208c.html2012-10-01 17:28 39K 
[TXT]fs0209a.html2012-10-01 17:32 16K 
[TXT]fs0209b.html2012-10-01 17:28 22K 
[TXT]fs0209c.html2012-10-01 17:33 19K 
[TXT]fs0209d.html2012-10-01 17:27 20K 
[TXT]fs951a.html2012-10-01 17:30 20K 
[TXT]fs951b.html2012-10-01 17:31 19K 
[TXT]fs951c.html2012-10-01 17:32 20K 
[TXT]fs951d.html2012-10-01 17:28 9.0K 
[TXT]fs952a.html2012-10-01 17:33 18K 
[TXT]fs952b.html2012-10-01 17:31 8.4K 
[TXT]fs952c.html2012-10-01 17:32 10K 
[TXT]fs952d.html2012-10-01 17:33 6.7K 
[TXT]fs952e.html2012-10-01 17:31 17K 
[TXT]fs953a.html2012-10-01 17:33 9.5K 
[TXT]fs953b.html2012-10-01 17:31 6.8K 
[TXT]fs953c.html2012-10-01 17:33 19K 
[TXT]fs953d.html2012-10-01 17:34 13K 
[TXT]fs953e.html2012-10-01 17:34 16K 
[TXT]fs954a.html2012-10-01 17:34 18K 
[TXT]fs954b.html2012-10-01 17:32 33K 
[TXT]fs954c.html2012-10-01 17:31 19K 
[TXT]fs955a.html2012-10-01 17:31 18K 
[TXT]fs955b.html2012-10-01 17:34 20K 
[TXT]fs955c.html2012-10-01 17:29 19K 
[TXT]fs955d.html2012-10-01 17:34 20K 
[TXT]fs956a.html2012-10-01 17:33 38K 
[TXT]fs956b.html2012-10-01 17:33 31K 
[TXT]fs957a.html2012-10-01 17:29 17K 
[TXT]fs957b.html2012-10-01 17:33 17K 
[TXT]fs957c.html2012-10-01 17:33 9.2K 
[TXT]fs957d.html2012-10-01 17:31 5.3K 
[TXT]fs957e.html2012-10-01 17:28 8.1K 
[TXT]fs958a.html2012-10-01 17:34 22K 
[TXT]fs958d.html2012-10-01 17:32 18K 
[TXT]fs958e.html2012-10-01 17:32 19K 
[TXT]fs958f.html2012-10-01 17:31 7.1K 
[TXT]fs959a.html2012-10-01 17:32 19K 
[TXT]fs959b.html2012-10-01 17:28 4.7K 
[TXT]fs959c.html2012-10-01 17:30 16K 
[TXT]fs959d.html2012-10-01 17:29 15K 
[TXT]fs961a.html2012-10-01 17:33 19K 
[TXT]fs961b.html2012-10-01 17:32 19K 
[TXT]fs961c.html2012-10-01 17:34 16K 
[TXT]fs961d.html2012-10-01 17:32 21K 
[TXT]fs962a.html2012-10-01 17:28 17K 
[TXT]fs962b.html2012-10-01 17:28 19K 
[TXT]fs962c.html2012-10-01 17:28 3.5K 
[TXT]fs962d.html2012-10-01 17:28 17K 
[TXT]fs962e.html2012-10-01 17:29 19K 
[TXT]fs963a.html2012-10-01 17:27 18K 
[TXT]fs963b.html2012-10-01 17:33 4.2K 
[TXT]fs963c.html2012-10-01 17:31 14K 
[TXT]fs963d.html2012-10-01 17:28 19K 
[TXT]fs964a.html2012-10-01 17:34 22K 
[TXT]fs964b.html2012-10-01 17:28 19K 
[TXT]fs964c.html2012-10-01 17:32 3.1K 
[TXT]fs964d.html2012-10-01 17:31 19K 
[TXT]fs964e.html2012-10-01 17:34 18K 
[TXT]fs965a.html2012-10-01 17:29 19K 
[TXT]fs965b.html2012-10-01 17:28 15K 
[TXT]fs965c.html2012-10-01 17:31 19K 
[TXT]fs965d.html2012-10-01 17:29 16K 
[TXT]fs965e.html2012-10-01 17:30 2.2K 
[TXT]fs966a.html2012-10-01 17:32 16K 
[TXT]fs966b.html2012-10-01 17:28 20K 
[TXT]fs966c.html2012-10-01 17:31 16K 
[TXT]fs966d.html2012-10-01 17:29 19K 
[TXT]fs967a.html2012-10-01 17:32 21K 
[TXT]fs967b.html2012-10-01 17:31 3.7K 
[TXT]fs967c.html2012-10-01 17:31 19K 
[TXT]fs967d.html2012-10-01 17:33 8.8K 
[TXT]fs967e.html2012-10-01 17:28 19K 
[TXT]fs967f.html2012-10-01 17:31 19K 
[TXT]fs968a.html2012-10-01 17:33 18K 
[TXT]fs968b.html2012-10-01 17:27 16K 
[TXT]fs968c.html2012-10-01 17:34 19K 
[TXT]fs968d.html2012-10-01 17:33 18K 
[TXT]fs969a.html2012-10-01 17:29 17K 
[TXT]fs969b.html2012-10-01 17:32 19K 
[TXT]fs969c.html2012-10-01 17:28 20K 
[TXT]fs969d.html2012-10-01 17:28 19K 
[TXT]fs971a.html2012-10-01 17:30 18K 
[TXT]fs971b.html2012-10-01 17:29 29K 
[TXT]fs971c.html2012-10-01 17:34 17K 
[TXT]fs972a.html2012-10-01 17:32 17K 
[TXT]fs972b.html2012-10-01 17:29 17K 
[TXT]fs972c.html2012-10-01 17:31 17K 
[TXT]fs972d.html2012-10-01 17:31 18K 
[TXT]fs973a.html2012-10-01 17:30 18K 
[TXT]fs973b.html2012-10-01 17:28 19K 
[TXT]fs973c.html2012-10-01 17:29 19K 
[TXT]fs973d.html2012-10-01 17:32 16K 
[TXT]fs974a.html2012-10-01 17:31 17K 
[TXT]fs974b.html2012-10-01 17:34 17K 
[TXT]fs974c.html2012-10-01 17:32 17K 
[TXT]fs974d.html2012-10-01 17:31 18K 
[TXT]fs975a.html2012-10-01 17:31 18K 
[TXT]fs975b.html2012-10-01 17:32 18K 
[TXT]fs975c.html2012-10-01 17:27 19K 
[TXT]fs975d.html2012-10-01 17:33 18K 
[TXT]fs976a.html2012-10-01 17:30 17K 
[TXT]fs976b.html2012-10-01 17:31 17K 
[TXT]fs976c.html2012-10-01 17:27 17K 
[TXT]fs976d.html2012-10-01 17:31 18K 
[TXT]fs977a.html2012-10-01 17:32 18K 
[TXT]fs977b.html2012-10-01 17:33 18K 
[TXT]fs977c.html2012-10-01 17:28 18K 
[TXT]fs977d.html2012-10-01 17:28 18K 
[TXT]fs978a.html2012-10-01 17:31 17K 
[TXT]fs978b.html2012-10-01 17:31 17K 
[TXT]fs978c.html2012-10-01 17:33 17K 
[TXT]fs978d.html2012-10-01 17:33 17K 
[TXT]fs979a.html2012-10-01 17:34 17K 
[TXT]fs979b.html2012-10-01 17:32 18K 
[TXT]fs979c.html2012-10-01 17:28 17K 
[TXT]fs979d.html2012-10-01 17:33 17K 
[TXT]fs981a.html2012-10-01 17:31 17K 
[TXT]fs981b.html2012-10-01 17:31 17K 
[TXT]fs981c.html2012-10-01 17:32 17K 
[TXT]fs981d.html2012-10-01 17:31 18K 
[TXT]fs982a.html2012-10-01 17:34 18K 
[TXT]fs982b.html2012-10-01 17:32 18K 
[TXT]fs982c.html2012-10-01 17:33 17K 
[TXT]fs982d.html2012-10-01 17:29 17K 
[TXT]fs983a.html2012-10-01 17:32 16K 
[TXT]fs983b.html2012-10-01 17:31 18K 
[TXT]fs983c.html2012-10-01 17:33 18K 
[TXT]fs983d.html2012-10-01 17:32 17K 
[TXT]fs984a.html2012-10-01 17:31 17K 
[TXT]fs984b.html2012-10-01 17:29 18K 
[TXT]fs984c.html2012-10-01 17:31 18K 
[TXT]fs984d.html2012-10-01 17:30 17K 
[TXT]fs985a.html2012-10-01 17:31 18K 
[TXT]fs985b.html2012-10-01 17:28 18K 
[TXT]fs985c.html2012-10-01 17:33 17K 
[TXT]fs985d.html2012-10-01 17:29 17K 
[TXT]fs986a.html2012-10-01 17:34 18K 
[TXT]fs986b.html2012-10-01 17:28 18K 
[TXT]fs986c.html2012-10-01 17:33 17K 
[TXT]fs986d.html2012-10-01 17:32 19K 
[TXT]fs987a.html2012-10-01 17:30 18K 
[TXT]fs987b.html2012-10-01 17:31 17K 
[TXT]fs987c.html2012-10-01 17:30 19K 
[TXT]fs987d.html2012-10-01 17:33 19K 
[TXT]fs988a.html2012-10-01 17:32 18K 
[TXT]fs988b.html2012-10-01 17:27 17K 
[TXT]fs988c.html2012-10-01 17:31 18K 
[TXT]fs988d.html2012-10-01 17:31 19K 
[TXT]fs989a.html2012-10-01 17:27 18K 
[TXT]fs989b.html2012-10-01 17:28 19K 
[TXT]fs989c.html2012-10-01 17:28 20K 
[TXT]fs989d.html2012-10-01 17:30 20K 
[TXT]fs991a.html2012-10-01 17:29 20K 
[TXT]fs991b.html2012-10-01 17:31 19K 
[TXT]fs991c.html2012-10-01 17:27 20K 
[TXT]fs991d.html2012-10-01 17:29 20K 
[TXT]fs992a.html2012-10-01 17:31 20K 
[TXT]fs992b.html2012-10-01 17:32 20K 
[TXT]fs992c.html2012-10-01 17:28 20K 
[TXT]fs992d.html2012-10-01 17:32 20K 
[TXT]fs993a.html2012-10-01 17:29 20K 
[TXT]fs993b.html2012-10-01 17:28 19K 
[TXT]fs993c.html2012-10-01 17:34 20K 
[TXT]fs993d.html2012-10-01 17:33 20K 
[TXT]fs994a.html2012-10-01 17:32 20K 
[TXT]fs994b.html2012-10-01 17:31 20K 
[TXT]fs994c.html2012-10-01 17:31 20K 
[TXT]fs994d.html2012-10-01 17:31 19K 
[TXT]fs995a.html2012-10-01 17:27 20K 
[TXT]fs995b.html2012-10-01 17:34 20K 
[TXT]fs995c.html2012-10-01 17:31 20K 
[TXT]fs995d.html2012-10-01 17:31 19K 
[TXT]fs996a.html2012-10-01 17:32 20K 
[TXT]fs996b.html2012-10-01 17:33 19K 
[TXT]fs996c.html2012-10-01 17:32 20K 
[TXT]fs996d.html2012-10-01 17:31 20K 
[TXT]fs997a.html2012-10-01 17:28 20K 
[TXT]fs997b.html2012-10-01 17:30 20K 
[TXT]fs997c.html2012-10-01 17:30 20K 
[TXT]fs997d.html2012-10-01 17:32 20K 
[TXT]fs998a.html2012-10-01 17:31 20K 
[TXT]fs998b.html2012-10-01 17:31 20K 
[TXT]fs998c.html2012-10-01 17:32 20K 
[TXT]fs998d.html2012-10-01 17:30 20K 
[TXT]fs999a.html2012-10-01 17:30 20K 
[TXT]fs999b.html2012-10-01 17:29 19K 
[TXT]fs999c.html2012-10-01 17:33 20K 
[TXT]fs999d.html2012-10-01 17:30 20K 
[TXT]fs9510a.html2012-10-01 17:33 18K 
[TXT]fs9510b.html2012-10-01 17:27 18K 
[TXT]fs9511a.html2012-10-01 17:34 19K 
[TXT]fs9511c.html2012-10-01 17:31 56K 
[TXT]fs9511d.html2012-10-01 17:28 19K 
[TXT]fs9512a.html2012-10-01 17:33 18K 
[TXT]fs9512b.html2012-10-01 17:31 13K 
[TXT]fs9512c.html2012-10-01 17:33 7.9K 
[TXT]fs9512d.html2012-10-01 17:34 16K 
[TXT]fs9611a.html2012-10-01 17:31 13K 
[TXT]fs9611b.html2012-10-01 17:29 19K 
[TXT]fs9611c.html2012-10-01 17:27 18K 
[TXT]fs9611d.html2012-10-01 17:31 14K 
[TXT]fs9612a.html2012-10-01 17:28 62K 
[TXT]fs9710a.html2012-10-01 17:30 17K 
[TXT]fs9710b.html2012-10-01 17:27 17K 
[TXT]fs9710c.html2012-10-01 17:32 18K 
[TXT]fs9710d.html2012-10-01 17:30 16K 
[TXT]fs9711a.html2012-10-01 17:31 18K 
[TXT]fs9711b.html2012-10-01 17:28 18K 
[TXT]fs9711c.html2012-10-01 17:30 17K 
[TXT]fs9711d.html2012-10-01 17:31 18K 
[TXT]fs9712a.html2012-10-01 17:31 18K 
[TXT]fs9712b.html2012-10-01 17:32 17K 
[TXT]fs9712c.html2012-10-01 17:28 17K 
[TXT]fs9712d.html2012-10-01 17:28 18K 
[TXT]fs9810a.html2012-10-01 17:32 20K 
[TXT]fs9810b.html2012-10-01 17:31 20K 
[TXT]fs9810c.html2012-10-01 17:31 20K 
[TXT]fs9810d.html2012-10-01 17:33 20K 
[TXT]fs9811a.html2012-10-01 17:31 20K 
[TXT]fs9811b.html2012-10-01 17:27 20K 
[TXT]fs9811c.html2012-10-01 17:29 20K 
[TXT]fs9811d.html2012-10-01 17:31 20K 
[TXT]fs9812a.html2012-10-01 17:31 20K 
[TXT]fs9812b.html2012-10-01 17:28 20K 
[TXT]fs9812c.html2012-10-01 17:33 20K 
[TXT]fs9812d.html2012-10-01 17:33 20K 
[TXT]fs9910a.html2012-10-01 17:31 20K 
[TXT]fs9910b.html2012-10-01 17:30 20K 
[TXT]fs9910c.html2012-10-01 17:30 20K 
[TXT]fs9910d.html2012-10-01 17:27 20K 
[TXT]fs9911a.html2012-10-01 17:31 20K 
[TXT]fs9911b.html2012-10-01 17:27 19K 
[TXT]fs9911c.html2012-10-01 17:29 20K 
[TXT]fs9911d.html2012-10-01 17:31 20K 
[TXT]fs9912a.html2012-10-01 17:31 20K 
[TXT]fs9912b.html2012-10-01 17:27 20K 
[TXT]fs9912c.html2012-10-01 17:31 19K 
[TXT]fs9912d.html2012-10-01 17:33 19K 
[   ]futureofman.pdf2012-10-01 17:27 1.5M 
[   ]ga-1-73.pdf2012-10-01 17:31 16M 
[   ]galileeflowers.pdf2012-10-01 17:33 2.3M 
[   ]galileeflowers.rtf2012-10-01 17:28 1.1M 
[   ]gas_prices.pdf2012-10-01 17:33 165K 
[TXT]getreadyforthecomingconflictwithchina.html2012-10-01 17:33 6.0K 
[   ]gibson.pdf2012-10-01 17:28 592K 
[   ]gibson_wm_docs_072806.pdf2012-10-01 17:31 248K 
[TXT]good_jewbad_jew_paradigm - The Mindset that Impedes Civilization's Healing Process.htm2012-10-01 17:31 26K 
[DIR]good_jewbad_jew_paradigm - The Mindset that Impedes Civilization's Healing Process_files/2015-10-04 18:43 -  
[   ]grafmemoir.pdf2012-10-01 17:28 153K 
[   ]grafmemoir.rtf2012-10-01 17:29 195K 
[   ]guilty.pdf2012-10-01 17:28 55K 
[TXT]gulag.html2012-10-01 17:32 3.1K 
[TXT]halfofprisonersareblack.html2012-10-01 17:31 4.6K 
[   ]hans.pdf2012-10-01 17:33 63K 
[   ]hate crime.pdf2012-10-01 17:33 409K 
[   ]hatecrimespamphlet.pdf2012-10-01 17:30 62K 
[   ]hatedir.pdf2012-10-01 17:31 1.0M 
[   ]hate directory.pdf2012-10-01 17:31 392K 
[TXT]he Jewish Conquest of the World.htm2012-10-01 17:30 71K 
[TXT]hey're Not All Bad...Are They.htm2012-10-01 17:28 9.6K 
[DIR]hey're Not All Bad...Are They_files/2015-10-04 18:43 -  
[   ]hey_you.pdf2012-10-01 17:31 121K 
[TXT]hidden.html2012-10-01 17:31 13K 
[TXT]history.html2012-10-01 17:33 51K 
[   ]histwiz 1.pdf2012-10-01 17:34 8.7M 
[   ]histwiz 2.pdf2012-10-01 17:28 1.8M 
[   ]histwiz 3.pdf2012-10-01 17:33 1.7M 
[   ]histwiz 4.pdf2012-10-01 17:29 159K 
[   ]hoax.pdf2012-10-01 17:33 13M 
[   ]hoax.rtf2012-10-01 17:33 16M 
[   ]hoax.zip2012-10-01 17:32 2.3M 
[   ]hoax2.pdf2012-10-01 17:31 1.2M 
[   ]holindustry.pdf2012-10-01 17:31 554K 
[   ]holindustry.rtf2012-10-01 17:33 5.3M 
[   ]holocaustorhoax.pdf2012-10-01 17:34 1.0M 
[   ]holocaustorhoax.rtf2012-10-01 17:31 605K 
[   ]hsb.pdf2012-10-01 17:28 443K 
[   ]hsb.rtf2012-10-01 17:29 1.2M 
[   ]hsb.zip2012-10-01 17:30 205K 
[   ]htpt.pdf2012-10-01 17:28 865K 
[   ]htpt.rtf2012-10-01 17:34 474K 
[TXT]http__www.hartford-hwp.com_cp-usa.html2012-10-01 17:31 1.9K 
[   ]human_shields.pdf2012-10-01 17:28 471K 
[TXT]humor.html2012-10-01 17:31 22K 
[TXT]hunter.css2012-10-01 17:28 503  
[TXT]hwr60.htm2012-10-01 17:28 35K 
[TXT]hwr61.htm2012-10-01 17:32 10K 
[TXT]ij01.html2012-10-01 17:28 32K 
[TXT]ij02.html2012-10-01 17:28 20K 
[TXT]ij03.html2012-10-01 17:32 21K 
[TXT]ij04.html2012-10-01 17:33 24K 
[TXT]ij05.html2012-10-01 17:27 30K 
[TXT]ij06.html2012-10-01 17:31 16K 
[TXT]ij07.html2012-10-01 17:28 17K 
[TXT]ij08.html2012-10-01 17:28 25K 
[TXT]ij09.html2012-10-01 17:33 27K 
[TXT]ij10.html2012-10-01 17:29 18K 
[TXT]ij11.html2012-10-01 17:33 25K 
[TXT]ij12.html2012-10-01 17:28 26K 
[TXT]ij13.html2012-10-01 17:32 26K 
[TXT]ij14.html2012-10-01 17:28 23K 
[TXT]ij15.html2012-10-01 17:32 26K 
[TXT]ij16.html2012-10-01 17:31 26K 
[TXT]ij17.html2012-10-01 17:29 31K 
[TXT]ij18.html2012-10-01 17:28 24K 
[TXT]ij19.html2012-10-01 17:29 24K 
[TXT]ij20.html2012-10-01 17:30 25K 
[TXT]ij21.html2012-10-01 17:28 25K 
[TXT]ij22.html2012-10-01 17:33 24K 
[TXT]ij23.html2012-10-01 17:32 25K 
[TXT]ij24.html2012-10-01 17:27 26K 
[TXT]ij25.html2012-10-01 17:28 24K 
[TXT]ij26.html2012-10-01 17:31 21K 
[TXT]ij27.html2012-10-01 17:30 26K 
[TXT]ij28.html2012-10-01 17:31 23K 
[TXT]ij29.html2012-10-01 17:30 17K 
[TXT]ij30.html2012-10-01 17:31 20K 
[TXT]ij31.html2012-10-01 17:28 21K 
[TXT]ij32.html2012-10-01 17:32 22K 
[TXT]ij33.html2012-10-01 17:33 25K 
[TXT]ij34.html2012-10-01 17:29 24K 
[TXT]ij35.html2012-10-01 17:31 28K 
[TXT]ij36.html2012-10-01 17:29 25K 
[TXT]ij37.html2012-10-01 17:31 4.5K 
[TXT]ij38.html2012-10-01 17:33 16K 
[TXT]ij39.html2012-10-01 17:33 7.5K 
[TXT]ij40.html2012-10-01 17:30 26K 
[TXT]ij41.html2012-10-01 17:31 27K 
[TXT]ij42.html2012-10-01 17:31 25K 
[TXT]ij43.html2012-10-01 17:33 28K 
[TXT]ij44.html2012-10-01 17:30 30K 
[TXT]ij45.html2012-10-01 17:31 29K 
[TXT]ij46.html2012-10-01 17:29 26K 
[TXT]ij47.html2012-10-01 17:33 23K 
[TXT]ij48.html2012-10-01 17:33 27K 
[TXT]ij49.html2012-10-01 17:32 27K 
[TXT]ij50.html2012-10-01 17:31 23K 
[TXT]ij51.html2012-10-01 17:30 28K 
[TXT]ij52.html2012-10-01 17:31 26K 
[TXT]ij53.html2012-10-01 17:32 26K 
[TXT]ij54.html2012-10-01 17:31 25K 
[TXT]ij55.html2012-10-01 17:33 24K 
[TXT]ij56.html2012-10-01 17:31 24K 
[TXT]ij57.html2012-10-01 17:27 26K 
[TXT]ij58.html2012-10-01 17:33 25K 
[TXT]ij59.html2012-10-01 17:33 25K 
[TXT]ij60.html2012-10-01 17:28 26K 
[TXT]ij61.html2012-10-01 17:28 28K 
[TXT]ij62.html2012-10-01 17:31 25K 
[TXT]ij63.html2012-10-01 17:31 25K 
[TXT]ij64.html2012-10-01 17:33 21K 
[TXT]ij65.html2012-10-01 17:33 26K 
[TXT]ij66.html2012-10-01 17:28 27K 
[TXT]ij67.html2012-10-01 17:33 27K 
[TXT]ij68.html2012-10-01 17:28 28K 
[TXT]ij69.html2012-10-01 17:31 28K 
[TXT]ij70.html2012-10-01 17:33 24K 
[TXT]ij71.html2012-10-01 17:28 24K 
[TXT]ij72.html2012-10-01 17:32 21K 
[TXT]ij73.html2012-10-01 17:30 25K 
[TXT]ij74.html2012-10-01 17:30 22K 
[TXT]ij75.html2012-10-01 17:34 25K 
[TXT]ij76.html2012-10-01 17:30 26K 
[TXT]ij77.html2012-10-01 17:30 29K 
[TXT]ij78.html2012-10-01 17:31 29K 
[TXT]ij79.html2012-10-01 17:34 24K 
[TXT]ij80.html2012-10-01 17:34 24K 
[   ]immigrationmustcease.pdf2012-10-01 17:32 110K 
[   ]imperium-pdf.zip2012-10-01 17:28 1.3M 
[TXT]imperium.css2012-10-01 17:32 758  
[   ]imperium.zip2012-10-01 17:29 510K 
[TXT]indexfiles.html2012-10-01 17:27 15K 
[   ]infamy.pdf2012-10-01 17:31 313K 
[   ]intro - National Vanguard.pdf2012-10-01 17:32 1.4M 
[   ]intro.pdf2012-10-01 17:29 1.4M 
[TXT]introduction.html2012-10-01 17:34 9.2K 
[   ]irish.pdf2012-10-01 17:27 1.3M 
[TXT]irving.html2012-10-01 17:34 25K 
[   ]israel.pdf2012-10-01 17:30 532K 
[TXT]israeliespionageandillegaltechnologyretransfer.html2012-10-01 17:27 11K 
[TXT]israelsuspectedoftransferringuslaserweapondatatochina.html2012-10-01 17:33 7.9K 
[TXT]israelviolatesrulesonmissilesales.html2012-10-01 17:34 5.4K 
[   ]israelweapons.pdf2012-10-01 17:30 134K 
[   ]israelweapons.rtf2012-10-01 17:31 194K 
[   ]its_a_deal.pdf2012-10-01 17:27 1.1M 
[SND]iwc4jan.mp32012-10-01 17:33 3.5M 
[   ]izterrorfile.pdf2012-10-01 17:34 783K 
[   ]izterrorfile.rtf2012-10-01 17:33 515K 
[   ]jackson-report.pdf2012-10-01 17:32 719K 
[   ]jaws.pdf2012-10-01 17:33 321K 
[TXT]jew-archives-previous-latest-additions.htm2012-10-01 17:29 5.0K 
[TXT]jew-atrocities-blackmail_of_nations.html2012-10-01 17:28 2.1K 
[TXT]jew-atrocities-egypt1967.html2012-10-01 17:31 25K 
[TXT]jew-atrocities-folder.html2012-10-01 17:33 4.1K 
[TXT]jew-atrocities-hebron.html2012-10-01 17:29 20K 
[TXT]jew-atrocities-intifada.html2012-10-01 17:30 21K 
[TXT]jew-atrocities-iraq.html2012-10-01 17:31 16K 
[TXT]jew-atrocities-israelitorture.htm2012-10-01 17:34 32K 
[TXT]jew-atrocities-jewsagainstjews.html2012-10-01 17:31 3.5K 
[TXT]jew-atrocities-lebanon.html2012-10-01 17:31 76K 
[TXT]jew-atrocities-political-correctness-crimes.html2012-10-01 17:34 5.4K 
[TXT]jew-atrocities-slaves-jewish-slave-ship-owners.html2012-10-01 17:28 5.8K 
[TXT]jew-atrocities-slaves.html2012-10-01 17:34 7.1K 
[TXT]jew-communists-HUAC-Lists.htm2012-10-01 17:27 80K 
[TXT]jew-communists-joe-mccarthy-and-the-jews.html2012-10-01 17:33 43K 
[TXT]jew-communists-rothschild-banks.html2012-10-01 17:31 53K 
[TXT]jew-communists.html2012-10-01 17:31 30K 
[TXT]jew-crime-mob-russia-ussr.html2012-10-01 17:33 102K 
[TXT]jew-criminalsandspies-bentley.html2012-10-01 17:31 4.1K 
[TXT]jew-criminalsandspies-elitcher-max.html2012-10-01 17:30 4.1K 
[TXT]jew-criminalsandspies-feklisov.html2012-10-01 17:31 4.9K 
[TXT]jew-criminalsandspies-folder.html2012-10-01 17:30 4.4K 
[TXT]jew-criminalsandspies-fuchs.html2012-10-01 17:33 6.4K 
[TXT]jew-criminalsandspies-gold.html2012-10-01 17:30 4.2K 
[TXT]jew-criminalsandspies-greenglass-wife.html2012-10-01 17:34 4.0K 
[TXT]jew-criminalsandspies-greenglass.html2012-10-01 17:27 5.3K 
[TXT]jew-criminalsandspies-hall.html2012-10-01 17:31 23K 
[TXT]jew-criminalsandspies-oppenheimer-robert.html2012-10-01 17:30 11K 
[TXT]jew-criminalsandspies-perl.html2012-10-01 17:33 5.5K 
[TXT]jew-criminalsandspies-pollard.html2012-10-01 17:30 2.9K 
[TXT]jew-criminalsandspies-rosenberg.html2012-10-01 17:32 3.8K 
[TXT]jew-criminalsandspies-sobell.html2012-10-01 17:29 27K 
[TXT]jew-criminalsandspies-vanunu.html2012-10-01 17:28 19K 
[TXT]jew-genocide-USSRchristians-JAC.html2012-10-01 17:30 3.9K 
[TXT]jew-genocide-USSRchristians-antisemitismcrime.html2012-10-01 17:28 6.0K 
[TXT]jew-genocide-black-holocaust-abolition-myth.html2012-10-01 17:27 20K 
[TXT]jew-genocide-gentilehate.html2012-10-01 17:30 19K 
[TXT]jew-genocide-palestinian-qana.htm2012-10-01 17:32 18K 
[TXT]jew-jewishbankingandfinancialmanipulations-folder.html2012-10-01 17:33 26K 
[TXT]jew-jewishbankingandfinancialmanipulations-food-companies.html2012-10-01 17:29 9.6K 
[TXT]jew-jewishbankingandfinancialmanipulations-islam-off-dow-jones.html2012-10-01 17:28 20K 
[TXT]jew-jewishbankingandfinancialmanipulations-mcfadden-speech.html2012-10-01 17:31 104K 
[TXT]jew-jewishbankingandfinancialmanipulations-secretsofthefederalreservebyeustace mullins.html2012-10-01 17:32 603K 
[TXT]jew-jewishsupremacyassociationsmovements-art-organizations.html2012-10-01 17:32 7.2K 
[TXT]jew-jewishsupremacyassociationsmovements-associations.html2012-10-01 17:28 108K 
[TXT]jew-jewishsupremacyassociationsmovements-cultural-ethnic-associations.html2012-10-01 17:33 15K 
[TXT]jew-jewishsupremacyassociationsmovements-environment-movements.html2012-10-01 17:28 7.0K 
[TXT]jew-jewishsupremacyassociationsmovements-family-women-sex-gender-issues.html2012-10-01 17:33 13K 
[TXT]jew-jewishsupremacyassociationsmovements-folder.html2012-10-01 17:33 5.1K 
[TXT]jew-jewishsupremacyassociationsmovements-foundations-grants-orgs.html2012-10-01 17:30 7.7K 
[TXT]jew-jewishsupremacyassociationsmovements-hate-genocide.html2012-10-01 17:31 7.5K 
[TXT]jew-jewishsupremacyassociationsmovements-immigration.html2012-10-01 17:30 6.5K 
[TXT]jew-jewishsupremacyassociationsmovements-law-rights.html2012-10-01 17:31 12K 
[TXT]jew-jewishsupremacyassociationsmovements-mass-media-associations.html2012-10-01 17:28 17K 
[TXT]jew-jewishsupremacyassociationsmovements-money-business-organizations.html2012-10-01 17:27 15K 
[TXT]jew-jewishsupremacyassociationsmovements-politics.html2012-10-01 17:27 22K 
[TXT]jew-jewishsupremacyassociationsmovements-religious.html2012-10-01 17:28 11K 
[TXT]jew-jewishsupremacyassociationsmovements-think-tanks-others.html2012-10-01 17:31 13K 
[TXT]jew-jewishsupremacyassociationsmovements-unions-occupations-others.html2012-10-01 17:29 16K 
[TXT]jew-jewishsupremacyassociationsmovements-universities.html2012-10-01 17:31 18K 
[TXT]jew-leaders-attorneys.html2012-10-01 17:29 3.0K 
[TXT]jew-leaders-begin.html2012-10-01 17:33 9.0K 
[TXT]jew-leaders-ben-gurion.html2012-10-01 17:30 87K 
[TXT]jew-leaders-churchill.html2012-10-01 17:33 6.0K 
[TXT]jew-leaders-dayan.html2012-10-01 17:27 4.6K 
[TXT]jew-leaders-eisenhower.html2012-10-01 17:31 7.4K 
[TXT]jew-leaders-executives.html2012-10-01 17:28 3.7K 
[TXT]jew-leaders-famousjewslist.html2012-10-01 17:30 16K 
[TXT]jew-leaders-folder.html2012-10-01 17:34 9.3K 
[TXT]jew-leaders-frank.html2012-10-01 17:29 2.2K 
[TXT]jew-leaders-hertzl.html2012-10-01 17:28 2.7K 
[TXT]jew-leaders-kaganovich.html2012-10-01 17:31 45K 
[TXT]jew-leaders-kahane.html2012-10-01 17:34 3.4K 
[TXT]jew-leaders-luxemberg.html2012-10-01 17:27 24K 
[TXT]jew-leaders-mafia.html2012-10-01 17:30 4.5K 
[TXT]jew-leaders-netanyahu.html2012-10-01 17:34 3.1K 
[TXT]jew-leaders-rabin.html2012-10-01 17:31 1.9K 
[TXT]jew-leaders-roosevelt.html2012-10-01 17:31 5.7K 
[TXT]jew-leaders-rothschild.html2012-10-01 17:31 5.1K 
[TXT]jew-leaders-stalin.html2012-10-01 17:32 7.3K 
[TXT]jew-leaders-trotsky.htm2012-10-01 17:30 6.5K 
[TXT]jew-leaders-ussr-pm-yevgeny-primakov.html2012-10-01 17:31 3.6K 
[TXT]jew-leaders-yagoda.html2012-10-01 17:32 5.0K 
[TXT]jew-mafia.htm2012-10-01 17:33 26K 
[TXT]jew-mindcontrol-anarchism.html2012-10-01 17:29 12K 
[TXT]jew-mindcontrol-atheism.html2012-10-01 17:30 88K 
[TXT]jew-mindcontrol-civil-rights.html2012-10-01 17:30 9.4K 
[TXT]jew-mindcontrol-communism.html2012-10-01 17:27 8.3K 
[TXT]jew-mindcontrol-feminism.html2012-10-01 17:30 25K 
[TXT]jew-mindcontrol-folder.html2012-10-01 17:29 3.8K 
[TXT]jew-mindcontrol-freudianism.html2012-10-01 17:33 60K 
[TXT]jew-mindcontrol-homosexuality.html2012-10-01 17:28 14K 
[TXT]jew-mindcontrol-immigration.html2012-10-01 17:33 3.8K 
[TXT]jew-mindcontrol-liberalism.html2012-10-01 17:34 5.0K 
[TXT]jew-mindcontrol-new-left.html2012-10-01 17:28 319K 
[TXT]jew-occupiedgovernments-CIS.html2012-10-01 17:30 2.5K 
[TXT]jew-occupiedgovernments-USSR-Jewish-Bolshevism-Bolsheviks.html2012-10-01 17:29 58K 
[TXT]jew-occupiedgovernments-USSR-historians.html2012-10-01 17:32 20K 
[TXT]jew-occupiedgovernments-USSR-jewish-bolsheviks-answer.com.html2012-10-01 17:33 34K 
[TXT]jew-occupiedgovernments-USSR-moreevidence - Historical Sources.htm2012-10-01 17:31 36K 
[DIR]jew-occupiedgovernments-USSR-moreevidence - Historical Sources_files/2015-10-04 18:43 -  
[TXT]jew-occupiedgovernments-USSR-moreevidence.html2012-10-01 17:33 36K 
[TXT]jew-occupiedgovernments-USSR-revolution.html2012-10-01 17:28 8.9K 
[TXT]jew-occupiedgovernments-USSR-victim-email.html2012-10-01 17:33 5.4K 
[TXT]jew-occupiedgovernments-USSR.html2012-10-01 17:34 122K 
[TXT]jew-occupiedgovernments-australia.html2012-10-01 17:29 2.1K 
[TXT]jew-occupiedgovernments-austria.html2012-10-01 17:30 3.7K 
[TXT]jew-occupiedgovernments-folder.html2012-10-01 17:32 2.4K 
[TXT]jew-occupiedgovernments-france.html2012-10-01 17:31 5.5K 
[TXT]jew-occupiedgovernments-germany-hitlers-jew-support.html2012-10-01 17:33 13K 
[TXT]jew-occupiedgovernments-germany.html2012-10-01 17:32 28K 
[TXT]jew-occupiedgovernments-israel-iq.html2012-10-01 17:33 149K 
[TXT]jew-occupiedgovernments-israel.html2012-10-01 17:27 47K 
[TXT]jew-occupiedgovernments-poland.html2012-10-01 17:28 7.1K 
[TXT]jew-occupiedgovernments-uk.html2012-10-01 17:34 12K 
[TXT]jew-occupiedgovernments-usa-sds.html2012-10-01 17:31 17K 
[TXT]jew-occupiedgovernments-usa.html2012-10-01 17:30 45K 
[TXT]jew-occupiedgovernments-vatican.html2012-10-01 17:32 26K 
[TXT]jew-organizations-ACLU.html2012-10-01 17:32 2.9K 
[TXT]jew-organizations-ADL.html2012-10-01 17:33 190K 
[TXT]jew-organizations-AIPAC.html2012-10-01 17:33 8.1K 
[TXT]jew-organizations-JDL-Zionist-Terror-Network-IHR.htm2012-10-01 17:27 107K 
[DIR]jew-organizations-JDL-Zionist-Terror-Network-IHR_files/2015-10-04 18:43 -  
[TXT]jew-organizations-JDL.html2012-10-01 17:28 3.1K 
[TXT]jew-organizations-NAACP.html2012-10-01 17:29 5.2K 
[TXT]jew-organizations-NOW.html2012-10-01 17:32 3.8K 
[TXT]jew-organizations-WZO.html2012-10-01 17:31 10K 
[TXT]jew-organizations-bnaibrith.html2012-10-01 17:28 30K 
[TXT]jew-organizations-folder.html2012-10-01 17:28 3.8K 
[TXT]jew-organizations-jewishbund.html2012-10-01 17:29 4.3K 
[TXT]jew-organizations-penetration-white-european-orgs.html2012-10-01 17:28 14K 
[TXT]jew-organizations-splc.html2012-10-01 17:27 13K 
[TXT]jew-organizations-wiesenthal.html2012-10-01 17:31 147K 
[TXT]jew-radio-folder.html2012-10-01 17:32 12K 
[TXT]jew-references-blogs.html2012-10-01 17:34 14K 
[TXT]jew-references-daskapital.html2012-10-01 17:31 3.7K 
[TXT]jew-references-gentile-whatotherssay - What world famous men said about the Jews.htm2012-10-01 17:33 86K 
[TXT]jew-religions-judaism.html2012-10-01 17:31 2.9K 
[TXT]jew-religions-millenium.html2012-10-01 17:33 6.3K 
[TXT]jew-terrorists-aipac-pentagon.html2012-10-01 17:27 3.5K 
[TXT]jew-terrorists-folder.html2012-10-01 17:31 5.1K 
[TXT]jew-terrorists-jewish-zionist-terrorists.html2012-10-01 17:32 15K 
[TXT]jew-terrorists-mossad.html2012-10-01 17:30 80K 
[TXT]jew-terrorists-shin_bet.html2012-10-01 17:31 15K 
[TXT]jew-usenet.html2012-10-01 17:28 2.1K 
[IMG]jew1.jpg2012-10-01 17:33 46K 
[IMG]jew2.jpg2012-10-01 17:34 53K 
[IMG]jewbrain.jpg2012-10-01 17:29 33K 
[   ]jewface.exe2012-10-01 17:27 11M 
[   ]jewish_media_control.pdf2012-10-01 17:33 627K 
[   ]jewish_supremacism.pdf2012-10-01 17:32 3.3M 
[   ]jewish involvement in immigration.pdf2012-10-01 17:31 192K 
[   ]jewish stake in immigration.pdf2012-10-01 17:30 93K 
[   ]jewishsupremacism.pdf2012-10-01 17:31 3.3M 
[   ]jewish supremacism preface.pdf2012-10-01 17:33 85K 
[   ]jewquestion.pdf2012-10-01 17:34 706K 
[   ]jewquestion.rtf2012-10-01 17:33 381K 
[TXT]jews.html2012-10-01 17:32 40K 
[IMG]jews.jpg2012-10-01 17:27 22K 
[TXT]jews beat Santa Clause.htm2012-10-01 17:33 30K 
[DIR]jews beat Santa Clause_files/2015-10-04 18:43 -  
[IMG]jewsgermany.jpg2012-10-01 17:34 262K 
[   ]joys.pdf2012-10-01 17:32 287K 
[   ]judeadeclareswar.pdf2012-10-01 17:31 84K 
[   ]just_say_yes.pdf2012-10-01 17:32 753K 
[   ]kdrebel.pdf2012-10-01 17:31 425K 
[   ]kdrebel.rtf2012-10-01 17:28 318K 
[   ]know_your_rights.pdf2012-10-01 17:28 7.6K 
[   ]kp-3.pdf2012-10-01 17:33 2.2M 
[TXT]leaderlessresistance.htm2012-10-01 17:28 22K 
[   ]leif_eriksson.pdf2012-10-01 17:32 395K 
[TXT]lemmingsrefusetoacceptfactsofracialdifferencesinintelligence.html2012-10-01 17:31 4.3K 
[   ]libby_indictment_28102005.pdf2012-10-01 17:33 153K 
[   ]lightningsun.pdf2012-10-01 17:33 1.4M 
[   ]lightningsun.rtf2012-10-01 17:28 5.3M 
[TXT]links.html2012-10-01 17:28 35K 
[   ]lipshit.pdf2012-10-01 17:30 1.5M 
[TXT]list-of-jews.htm2012-10-01 17:30 465K 
[DIR]list-of-jews_files/2015-10-04 18:43 -  
[SND]littlemary-mp3.ram2012-10-01 17:32 67  
[SND]littlemary.mp32012-10-01 17:32 3.3M 
[   ]lost_boy.pdf2012-10-01 17:33 291K 
[   ]lost_boy_2.pdf2012-10-01 17:30 328K 
[   ]lotrlit.zip2012-10-01 17:31 1.5M 
[   ]love-your-race.pdf2012-10-01 17:29 281K 
[   ]lwb.pdf2012-10-01 17:27 205K 
[TXT]main.css2012-10-01 17:32 1.0K 
[   ]maine.pdf2012-10-01 17:27 571K 
[   ]maine_rape.pdf2012-10-01 17:32 719K 
[   ]malleus_maleficarum.zip2012-10-01 17:28 795K 
[   ]manifeste.pdf2012-10-01 17:30 568K 
[   ]marchupcountry.pdf2012-10-01 17:31 892K 
[   ]marchupcountry.rtf2012-10-01 17:29 2.3M 
[TXT]mcveigh.htm2012-10-01 17:30 24K 
[   ]mcveigh.pdf2012-10-01 17:33 136K 
[DIR]mcveigh_files/2015-10-04 18:43 -  
[   ]mediabypass.pdf2012-10-01 17:29 745K 
[   ]meet_your_neighbors.pdf2012-10-01 17:32 1.6M 
[   ]meinkampf.rtf2012-10-01 17:31 3.5M 
[   ]meinkampf.zip2012-10-01 17:31 702K 
[TXT]memberapp.html2012-10-01 17:28 2.8K 
[   ]memories%20of%20freedom.pdf2012-10-01 17:30 4.5M 
[TXT]menu.htm2012-10-01 17:30 18K 
[TXT]minimanual.htm2012-10-01 17:27 29K 
[TXT]minoritieslagdespitefcatgains.html2012-10-01 17:33 5.8K 
[TXT]minoritytestscoregap.html2012-10-01 17:34 6.6K 
[TXT]misc.html2012-10-01 17:33 32K 
[   ]missing.pdf2012-10-01 17:32 1.0M 
[   ]mlk.pdf2012-10-01 17:32 608K 
[   ]mlkday.pdf2012-10-01 17:33 464K 
[   ]mlkflyer.pdf2012-10-01 17:30 92K 
[   ]morel.pdf2012-10-01 17:32 342K 
[   ]ms13_us.pdf2012-10-01 17:29 296K 
[   ]mumiamurderer.pdf2012-10-01 17:31 277K 
[TXT]music.html2012-10-01 17:33 61K 
[   ]nascar.pdf2012-10-01 17:28 61K 
[   ]nationontrial.pdf2012-10-01 17:31 540K 
[   ]nationontrial.rtf2012-10-01 17:32 291K 
[TXT]nazism - White Pride.htm2012-10-01 17:31 19K 
[TXT]nc.photos.html2012-10-01 17:31 5.1K 
[   ]neonazi-chart.pdf2012-10-01 17:30 70K 
[   ]ner.pdf2012-10-01 17:31 1.1M 
[TXT]nettinin04112006.html2012-10-01 17:30 113K 
[   ]newsletter_092005.pdf2012-10-01 17:28 1.2M 
[TXT]newyorkandhillaryschineserockets.html2012-10-01 17:31 4.9K 
[TXT]ninety_five_theses_on_the_holoca - Ninety Five Theses on the Holocaust.htm2012-10-01 17:31 35K 
[DIR]ninety_five_theses_on_the_holoca - Ninety Five Theses on the Holocaust_files/2015-10-04 18:43 -  
[   ]no_place_1.pdf2012-10-01 17:29 802K 
[TXT]noose.htm2012-10-01 17:28 11K 
[DIR]noose_files/2015-10-04 18:43 -  
[   ]notes on Phenomenology.doc2012-10-01 17:31 580K 
[   ]notguilty.pdf2012-10-01 17:33 211K 
[   ]notguilty.rtf2012-10-01 17:28 142K 
[   ]nowarforisrael.pdf2012-10-01 17:32 8.2K 
[   ]nuremberg.pdf2012-10-01 17:30 1.5M 
[   ]nv_terrorfree.pdf2012-10-01 17:31 571K 
[   ]nv_ussliberty.pdf2012-10-01 17:28 156K 
[   ]nv_warforisrael.pdf2012-10-01 17:31 114K 
[   ]ocbpt.pdf2012-10-01 17:31 3.3M 
[   ]ocbpt.rtf2012-10-01 17:31 5.8M 
[   ]ocbpt.zip2012-10-01 17:33 3.5M 
[   ]ohio college crime - 5349405.pdf2012-10-01 17:28 30K 
[TXT]ohn Lennon's 'Imagine' (revised).htm2012-10-01 17:32 7.5K 
[DIR]ohn Lennon's 'Imagine' (revised)_files/2015-10-04 18:43 -  
[TXT]opphack.htm2012-10-01 17:31 1.7K 
[   ]oppressed.pdf2012-10-01 17:31 1.1M 
[   ]paleoamericanethnicdiversity.doc2012-10-01 17:33 256K 
[   ]panels.pdf2012-10-01 17:31 260K 
[   ]pearlharbor.pdf2012-10-01 17:27 559K 
[   ]peltreport.pdf2012-10-01 17:33 1.5M 
[   ]peltreport.rtf2012-10-01 17:31 2.0M 
[   ]pipe.pdf2012-10-01 17:33 1.5M 
[   ]pipermel.pdf2012-10-01 17:30 1.0M 
[   ]pledge.pdf2012-10-01 17:29 722K 
[IMG]poster1470.jpg2012-10-01 17:32 113K 
[TXT]printer.php.htm2012-10-01 17:30 5.2K 
[DIR]printer.php_files/2015-10-04 18:43 -  
[   ]prison_camps.pdf2012-10-01 17:31 774K 
[   ]puddingrecipe .pdf2012-10-01 17:32 1.2M 
[   ]putting_israel_first.pdf2012-10-01 17:28 1.1M 
[   ]race-mixing1.pdf2012-10-01 17:28 856K 
[   ]race_traitor.pdf2012-10-01 17:28 1.3M 
[   ]racebook.doc2012-10-01 17:34 683K 
[TXT]racialgapinschoolssplitsatownproudofdiversity.html2012-10-01 17:32 16K 
[TXT]racialgapremainswideonmcasscores.html2012-10-01 17:33 9.1K 
[   ]raffle2005.pdf2012-10-01 17:31 451K 
[   ]rahowa.pdf2012-10-01 17:29 1.0M 
[TXT]renaissance.html2012-10-01 17:27 42K 
[TXT]reportblackslikelytobespecialedstudents.html2012-10-01 17:27 1.6K 
[TXT]resistancetoday.htm2012-10-01 17:34 80K 
[   ]revisionistpamphlets.pdf2012-10-01 17:31 481K 
[   ]revisionistpamphlets.rtf2012-10-01 17:30 355K 
[   ]rights.pdf2012-10-01 17:27 47K 
[TXT]rtc_1-01.html2012-10-01 17:30 22K 
[TXT]rtc_1-02.html2012-10-01 17:33 58K 
[TXT]rtc_1-03.html2012-10-01 17:33 51K 
[TXT]rtc_1-04.html2012-10-01 17:31 26K 
[TXT]rtc_1-05.html2012-10-01 17:28 61K 
[TXT]rtc_2-06.html2012-10-01 17:28 13K 
[TXT]rtc_2-07.html2012-10-01 17:30 29K 
[TXT]rtc_2-08.html2012-10-01 17:30 37K 
[TXT]rtc_2-09.html2012-10-01 17:28 37K 
[TXT]rtc_3-10.html2012-10-01 17:28 17K 
[TXT]rtc_3-11.html2012-10-01 17:32 97K 
[TXT]rtc_3-12.html2012-10-01 17:33 18K 
[TXT]rtc_intro.html2012-10-01 17:28 22K 
[TXT]rtc_preface.html2012-10-01 17:32 4.5K 
[   ]rvtr.pdf2012-10-01 17:33 930K 
[   ]rwp_06_011_walt.pdf2012-10-01 17:29 1.2M 
[   ]sacred_cavern.zip2012-10-01 17:31 423K 
[TXT]sales.html2012-10-01 17:31 30K 
[   ]savitri-pdf.zip2012-10-01 17:33 1.3M 
[   ]saynotoextinction.pdf2012-10-01 17:29 26K 
[   ]scamway.pdf2012-10-01 17:29 1.7M 
[TXT]schoolsfacecivilrightsprobe.html2012-10-01 17:28 5.9K 
[   ]secondchance.pdf2012-10-01 17:30 130K 
[   ]security_911_2005color.pdf2012-10-01 17:30 216K 
[   ]send_the_goyim.pdf2012-10-01 17:29 844K 
[   ]shadow.pdf2012-10-01 17:30 633K 
[   ]shakedown2.pdf2012-10-01 17:30 1.0M 
[   ]shamiressays.pdf2012-10-01 17:29 876K 
[   ]shamiressays.rtf2012-10-01 17:33 1.0M 
[TXT]shelby - Terrorism In South Africa.htm2012-10-01 17:28 17K 
[DIR]shelby - Terrorism In South Africa_files/2015-10-04 18:43 -  
[TXT]shirts.html2012-10-01 17:32 18K 
[   ]shongum_001-020.doc2012-10-01 17:32 788K 
[   ]shongum_021-050.doc2012-10-01 17:27 343K 
[   ]shongum_051-070.doc2012-10-01 17:28 494K 
[   ]shongum_071-096.doc2012-10-01 17:31 323K 
[   ]shongum_097-122.doc2012-10-01 17:33 229K 
[   ]shongum_123-150.doc2012-10-01 17:28 786K 
[   ]shongum_151-168.doc2012-10-01 17:27 552K 
[   ]shongum_BIBLIOG_REFS.doc2012-10-01 17:30 21K 
[   ]shongum_preface.doc2012-10-01 17:31 333K 
[   ]shongum_preface.xhtml2012-10-01 17:28 26K 
[   ]shufeldt.pdf2012-10-01 17:29 4.9M 
[   ]sikorski.pdf2012-10-01 17:31 937K 
[   ]sl.pdf2012-10-01 17:34 1.0M 
[   ]smash.pdf2012-10-01 17:31 56K 
[   ]smell_the_blood.pdf2012-10-01 17:33 846K 
[IMG]solzhenitsyn photo.jpg2012-10-01 17:30 14K 
[   ]specialtreatment.pdf2012-10-01 17:27 6.8M 
[IMG]spiderjew.jpg2012-10-01 17:34 6.9K 
[   ]srebrenica.pdf2012-10-01 17:30 15M 
[   ]ssracetheory.pdf2012-10-01 17:29 2.7M 
[TXT]stayawayfromblackdoctors.html2012-10-01 17:32 5.1K 
[   ]stupidwhitemen.pdf2012-10-01 17:27 1.4M 
[TXT]stylesheet.css2012-10-01 17:31 5.1K 
[   ]swazi.ttf2012-10-01 17:32 46K 
[   ]t.zip2012-10-01 17:34 2.1M 
[TXT]teachertestshowswideracialgap.html2012-10-01 17:30 6.3K 
[TXT]testscoreprobesought.html2012-10-01 17:30 6.4K 
[   ]tfh.pdf2012-10-01 17:30 3.7M 
[   ]tfh.zip2012-10-01 17:30 2.4M 
[DIR]thadanderson-American_Revolution_Docs/2015-10-04 18:43 -  
[DIR]thadanderson-Civil_War_Docs/2015-10-04 18:43 -  
[DIR]thadanderson-WWII_Docs/2015-10-04 18:43 -  
[   ]thcov.pdf2012-10-01 17:28 812K 
[   ]the_talmud.pdf2012-10-01 17:33 199K 
[   ]the_truth.pdf2012-10-01 17:34 280K 
[   ]thecause.pdf2012-10-01 17:29 166K 
[TXT]thecoxreport.html2012-10-01 17:33 10K 
[TXT]thequietscourge.html2012-10-01 17:31 5.0K 
[TXT]thetanserstudy.html2012-10-01 17:32 7.8K 
[   ]theywereslaves.pdf2012-10-01 17:28 3.3M 
[   ]theywereslaves.rtf2012-10-01 17:28 2.4M 
[TXT]thinking.htm2012-10-01 17:33 25K 
[DIR]thinking_files/2015-10-04 18:43 -  
[TXT]thousandsattendvoodoofestival.html2012-10-01 17:33 4.0K 
[   ]tiffany_long.pdf2012-10-01 17:33 498K 
[   ]tilak-pdf.zip2012-10-01 17:30 1.6M 
[   ]tipsforthewrittenexamination.pdf2012-10-01 17:30 170K 
[   ]tob_shebbe_goyim_harog_first6.pdf2012-10-01 17:31 758K 
[   ]too_white.pdf2012-10-01 17:33 456K 
[   ]too_white_sm.pdf2012-10-01 17:33 460K 
[   ]tor2005-224.pdf2012-10-01 17:34 189K 
[   ]traffic.pdf2012-10-01 17:28 419K 
[   ]trr.pdf2012-10-01 17:31 4.2M 
[   ]trr.zip2012-10-01 17:32 1.4M 
[   ]turn_it_down_resource_kit.pdf2012-10-01 17:28 508K 
[   ]turnerdiaries.zip2012-10-01 17:34 279K 
[   ]ulysses.pdf2012-10-01 17:30 1.0M 
[   ]ulysses.rtf2012-10-01 17:30 3.9M 
[TXT]upperclassblackstudentsunderperforming.html2012-10-01 17:33 7.1K 
[   ]urban guerilla.pdf2012-10-01 17:31 73K 
[TXT]usbegsjewstostopsellingmilitarytechnologytochina.html2012-10-01 17:32 3.4K 
[TXT]uscollegetestatcenterofracechargeddebate.html2012-10-01 17:31 5.8K 
[TXT]usseekstocurbisraeliarmssalestochina.html2012-10-01 17:33 15K 
[TXT]ustechnologyappearsinnewchinesewarplaneviaisrael.html2012-10-01 17:27 12K 
[   ]vargsmal.zip2012-10-01 17:33 101K 
[   ]vfsky.pdf2012-10-01 17:31 83K 
[TXT]video.html2012-10-01 17:32 50K 
[   ]vnntaa1a.pdf2012-10-01 17:33 1.3M 
[   ]vnntaa2.pdf2012-10-01 17:32 1.7M 
[   ]vnntaa3.pdf2012-10-01 17:28 1.4M 
[TXT]wausau.htm2012-10-01 17:32 39K 
[   ]weekly report 01.pdf2012-10-01 17:31 363K 
[TXT]whatsnew.htm2012-10-01 17:28 6.4K 
[   ]where_are_wmd.pdf2012-10-01 17:31 92K 
[TXT]whitesblacks100factsandonelie.html2012-10-01 17:31 62K 
[   ]why_reverse_evolution.pdf2012-10-01 17:33 209K 
[   ]why_reverse_evolution_color.pdf2012-10-01 17:34 629K 
[TXT]whydoblackstudentslagbehind.html2012-10-01 17:28 16K 
[TXT]whyisafricapoor.html2012-10-01 17:28 20K 
[TXT]wiesenthal - fake holocaust.htm2012-10-01 17:27 16K 
[DIR]wiesenthal - fake holocaust_files/2015-10-04 18:43 -  
[   ]wiretap.pdf2012-10-01 17:29 454K 
[   ]wmb.pdf2012-10-01 17:31 1.3M 
[TXT]wn-urls.txt2012-10-01 17:33 4.7K 
[   ]wood103.pdf2012-10-01 17:31 197K 
[   ]wra.pdf2012-10-01 17:31 289K 
[   ]wra2004.pdf2012-10-01 17:32 900K 
[   ]wraflyer.pdf2012-10-01 17:32 45K 
[   ]wtc1.pdf2012-10-01 17:31 5.3M 
[   ]wvr.pdf2012-10-01 17:34 13M 
[DIR]www.iraqthejewswar.com/2012-10-01 17:29 -  
[   ]yellow.pdf2012-10-01 17:33 1.0M 
[   ]youre_fired.pdf2012-10-01 17:28 1.3M 
[   ]zionistcoverup.pdf2012-10-01 17:33 1.4M 
[   ]zionistcoverup.rtf2012-10-01 17:31 1.0M 
[TXT]zogencryption.htm2012-10-01 17:27 21K 
[DIR]zogencryption_files/2015-10-04 18:43 -  

The Macintosh Archive does not claim rights to any files held herein.
To the best of our knowledge all titles have been discontinued by their publishers.
Rights owners may contact us; All removal requests are taken very seriously.